DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG2129

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:477 Identity:127/477 - (26%)
Similarity:212/477 - (44%) Gaps:84/477 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PDVAGGYHNLRCGEVLFSAPASYEVSCLLCDQRLPLDG-YPEHFRLKHF------TNSSSSLCSN 65
            ||...|..|.:|||:.|.:..|:.:.|..|:.:..:.| :..|.:..||      |.::.:..:.
  Fly     7 PDTYAGMANAKCGEIYFQSLHSFRIDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTEATDAGANL 71

  Fly    66 ELESD---------PIAQDV-----VEVQGNEELHEELAKEASPDLEEEEEEKEEGSKR-----Q 111
            :.|.|         ||...|     .|:.|:   |.|.:.:....||:::|:::|...|     |
  Fly    72 KQERDREREPNSPVPIVAQVNPFAWYEIGGD---HNEDSDDERVVLEKQDEDEDERPGRSIIKWQ 133

  Fly   112 HYQRAAAMKNTLVETREDLLDIELDWTGGEQSEHNETHEEEEGESDDDDTKDSNDTKDMLFQCDQ 176
            .:|...:      |:...:..:::|:      :..::.:||.|...|.|::..:..| :...|..
  Fly   134 DHQSLTS------ESLRQVRALKVDY------KEEDSEQEECGMELDLDSEGRHSAK-IPHSCPH 185

  Fly   177 CDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKR---KGPPKVYKCNEEACNQTFRTERD 238
            |.:.|.:::.|:.|...:|.:.....:|...::....|.   |...:.|||  |.|.:.:..:..
  Fly   186 CTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKC--EHCGKIYHGKYS 248

  Fly   239 LRGHRWK-----------------------------------HTGIFCDICGKPFTQSGNMMRHR 268
            ||.|..:                                   |.|..|.:||:.:.....:.||:
  Fly   249 LRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKTRHELKRHQ 313

  Fly   269 QRHSGIKPHKCPE--CDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGER 331
            .:|:..:...||.  |...|:|.:.:.:|...||.:...:||.||..||::..|..|:|.|||||
  Fly   314 LKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGER 378

  Fly   332 PAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGK 396
            |..|:||.|.|.|...|..|...|:..||.||.|||:||.|:|.|..||.||::.:::.|||||.
  Fly   379 PFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGN 443

  Fly   397 TFAQSGGLNAHMRSHDPARVKG 418
            .:||:.||..|||.|....:.|
  Fly   444 AYAQAAGLAGHMRKHRNDELNG 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/56 (11%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
COG5048 <256..415 CDD:227381 64/160 (40%)
zf-H2C2_2 263..288 CDD:290200 7/26 (27%)
C2H2 Zn finger 279..327 CDD:275368 17/49 (35%)
zf-H2C2_2 320..342 CDD:290200 13/21 (62%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 11/19 (58%)
zf-C2H2 389..411 CDD:278523 12/21 (57%)
C2H2 Zn finger 391..411 CDD:275368 12/19 (63%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 5/19 (26%)
zf-C2H2_8 323..411 CDD:292531 35/87 (40%)
C2H2 Zn finger 327..346 CDD:275368 4/18 (22%)
C2H2 Zn finger 354..374 CDD:275368 9/19 (47%)
zf-H2C2_2 367..389 CDD:290200 13/21 (62%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-H2C2_2 395..419 CDD:290200 12/23 (52%)
C2H2 Zn finger 410..430 CDD:275368 11/19 (58%)
C2H2 Zn finger 438..458 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.