DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG2120

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:274 Identity:73/274 - (26%)
Similarity:110/274 - (40%) Gaps:71/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 NGGS-------LDKSASERNSKKRKGPPKVYKCNEEACNQTFRTE-RDLRGHRWKHTGIFCDICG 255
            |.||       ::.:..:||:.:.| |..:.|.......:..||. :|       ||   ||||.
  Fly    52 NPGSEYDLLELVNGALQQRNTTEHK-PTDMCKPKRTPTTKRHRTTGKD-------HT---CDICD 105

  Fly   256 KPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVL 320
            :.|:::.|:..|:..|:..|||.|.||...|....:|..|::.||...|..|::||:..|....|
  Fly   106 RRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYL 170

  Fly   321 TAHMRRHTGERPAKCEV--CGKAFYSFHD------------------------------------ 347
            |.|.|.||||:|..|..  |..:|:|.|.                                    
  Fly   171 TVHRRLHTGEKPYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTC 235

  Fly   348 ------------LNVHAVSHTNLRPFVC--DVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTF 398
                        |::|...|.|.|.|.|  ..||..|.....|:.|::.|::||.:||.||...|
  Fly   236 PVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARF 300

  Fly   399 AQSGGLNAHMRSHD 412
            .:......|::.|:
  Fly   301 LRKSNHKQHLKVHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 3/22 (14%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 56/209 (27%)
zf-H2C2_2 263..288 CDD:290200 10/24 (42%)
C2H2 Zn finger 279..327 CDD:275368 17/47 (36%)
zf-H2C2_2 320..342 CDD:290200 11/23 (48%)
C2H2 Zn finger 335..355 CDD:275368 7/69 (10%)
C2H2 Zn finger 363..383 CDD:275368 6/21 (29%)
zf-C2H2 389..411 CDD:278523 6/21 (29%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 7/19 (37%)
zf-H2C2_2 113..138 CDD:290200 10/24 (42%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
zf-H2C2_2 142..166 CDD:290200 8/23 (35%)
COG5048 151..>264 CDD:227381 25/112 (22%)
C2H2 Zn finger 157..177 CDD:275368 8/19 (42%)
C2H2 Zn finger 185..206 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 2/19 (11%)
C2H2 Zn finger 263..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.