DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and znf-782

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_500033.1 Gene:znf-782 / 190310 WormBaseID:WBGene00021931 Length:662 Species:Caenorhabditis elegans


Alignment Length:446 Identity:104/446 - (23%)
Similarity:156/446 - (34%) Gaps:123/446 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TNSSSSLCSNELESDPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMK 120
            |.::::|..:....||      |.:..||..:||       ||||||..||..:.::...|::: 
 Worm     9 TTTNTTLPDDIHMKDP------EEEEFEEYEDEL-------LEEEEEFDEELEELENSDSASSL- 59

  Fly   121 NTLVETREDLLDIELDWTGGEQSEHN--------ETHEEEEGESDDDDTKDSNDTKDMLFQCDQC 177
                        :......|..|.:.        :.....:|...........:.:.:   |..|
 Worm    60 ------------VSAGSPHGSSSSNGSHGSSPPLQVQSPSQGSGSSGSPTGQPEKRHI---CTVC 109

  Fly   178 DRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGH 242
            .:.::....|:||:|....|                      |.|.|:  .|.:||..:..|:.|
 Worm   110 GKGFSYFSILESHKRSHTGE----------------------KPYNCH--FCQKTFAQKATLQVH 150

  Fly   243 RWKHTG---IFCDICGKPFTQSGNMMRH-RQRHSGIKPHKCPECDATFYTQKELSSHSICHTGR- 302
            ...|||   ..|..|.|.|.|.|....| :..|.||:.:|||:||....:...|.:|...|..: 
 Worm   151 ERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKT 215

  Fly   303 MPC----------------------------ICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCG 339
            ..|                            :|..|.:.....|.|..|:|.||||||..|:.|.
 Worm   216 FRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCP 280

  Fly   340 KAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQR----------------- 387
            |||.|..:|..|..:||..||:.|..|..||.:|..|..|:..|..|:                 
 Worm   281 KAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAG 345

  Fly   388 ---------KYACKLCGKTFAQSGGLNAHMRSHDPARV---KGAVKPLPQSVTIEV 431
                     .|.|..|.|.:..:..|..|||.|.....   .|..||..|.:::.:
 Worm   346 SVTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNI 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/21 (29%)
C2H2 Zn finger 251..271 CDD:275368 7/20 (35%)
COG5048 <256..415 CDD:227381 59/214 (28%)
zf-H2C2_2 263..288 CDD:290200 9/25 (36%)
C2H2 Zn finger 279..327 CDD:275368 14/76 (18%)
zf-H2C2_2 320..342 CDD:290200 12/21 (57%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:278523 8/21 (38%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
znf-782NP_500033.1 C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
zf-H2C2_2 119..143 CDD:290200 11/47 (23%)
C2H2 Zn finger 134..154 CDD:275368 6/21 (29%)
zf-H2C2_2 147..171 CDD:290200 9/23 (39%)
C2H2 Zn finger 162..180 CDD:275368 7/17 (41%)
COG5048 <187..404 CDD:227381 55/215 (26%)
C2H2 Zn finger 191..211 CDD:275370 6/19 (32%)
C2H2 Zn finger 218..239 CDD:275368 1/20 (5%)
C2H2 Zn finger 248..268 CDD:275368 6/19 (32%)
zf-H2C2_2 260..285 CDD:290200 14/24 (58%)
C2H2 Zn finger 276..296 CDD:275368 8/19 (42%)
zf-H2C2_2 288..313 CDD:290200 10/24 (42%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
C2H2 Zn finger 386..403 CDD:275368 4/16 (25%)
C2H2 Zn finger 424..441 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.