DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and ZNF366

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_689838.1 Gene:ZNF366 / 167465 HGNCID:18316 Length:744 Species:Homo sapiens


Alignment Length:391 Identity:91/391 - (23%)
Similarity:141/391 - (36%) Gaps:136/391 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTLVETREDLLDIELDWT-----GGEQSEHNET 148
            |.::|.|...||.::|.|                    |.| :::::|.:     ||.|..    
Human   213 LPRKAEPQESEETKQKVE--------------------RVD-VNVQIDDSYYVDVGGSQKR---- 252

  Fly   149 HEEEEGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSK 213
                                   :||..|:::|.:|.:|.:| .|.||..               
Human   253 -----------------------WQCPTCEKSYTSKYNLVTH-ILGHSGI--------------- 278

  Fly   214 KRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTGI---FCDICGKPFTQSGNMMRHRQRHSGIK 275
                  |.:.|..  |.:.|:....|..|...|.|.   .|.:|.|.|||:.::.||..:||.:|
Human   279 ------KPHACTH--CGKLFKQLSHLHTHMLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVK 335

  Fly   276 PH--------------------------------------------------------KCPECDA 284
            ||                                                        .|.|||.
Human   336 PHNCRVCGRGFAYPSELKAHEAKHASGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDK 400

  Fly   285 TFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLN 349
            ||....:|.:|.:.|....|.||..||........|..|...|.|.:..||.:||:.|....::.
Human   401 TFQYPSQLQNHMMKHKDIRPYICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMK 465

  Fly   350 VHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSHDPA 414
            .|.:.|||:|.:.|.:|..:|.:|:.|:.|.::||:.:.:.||||||.|.:...|..||..|..:
Human   466 RHVLIHTNIRAYQCHLCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDS 530

  Fly   415 R 415
            :
Human   531 K 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
COG5048 <256..415 CDD:227381 58/214 (27%)
zf-H2C2_2 263..288 CDD:290200 13/80 (16%)
C2H2 Zn finger 279..327 CDD:275368 16/47 (34%)
zf-H2C2_2 320..342 CDD:290200 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-C2H2 389..411 CDD:278523 10/21 (48%)
C2H2 Zn finger 391..411 CDD:275368 10/19 (53%)
ZNF366NP_689838.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..228 5/14 (36%)
COG5048 253..>549 CDD:227381 78/303 (26%)
C2H2 Zn finger 255..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 283..303 CDD:275368 5/21 (24%)
C2H2 Zn finger 311..331 CDD:275368 8/19 (42%)
C2H2 Zn finger 339..359 CDD:275368 0/19 (0%)
C2H2 Zn finger 367..387 CDD:275368 0/19 (0%)
C2H2 Zn finger 395..415 CDD:275368 8/19 (42%)
C2H2 Zn finger 423..443 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 5/19 (26%)
Interaction with NRIP1. /evidence=ECO:0000269|PubMed:17085477 455..744 26/77 (34%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
C2H2 Zn finger 507..527 CDD:275368 10/19 (53%)
C2H2 Zn finger 535..554 CDD:275368
PXDLS. /evidence=ECO:0000269|PubMed:16393996, ECO:0000269|PubMed:17085477 590..594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.