DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and ZNF570

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001287922.1 Gene:ZNF570 / 148268 HGNCID:26416 Length:592 Species:Homo sapiens


Alignment Length:454 Identity:127/454 - (27%)
Similarity:190/454 - (41%) Gaps:79/454 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SSSLCSN-----ELESDPIAQDVVEVQGNEELHEELAKEASPDLEE---EEEEKEEG-SKRQHYQ 114
            :..|||.     |.|.....||..|...::::.|.|   .|.:||.   .||.|.|| .:||...
Human   136 TKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETL---TSYNLEYSSLREEWKCEGYFERQPGN 197

  Fly   115 RAAAMKNTLVETREDLLDIE----LDWTGGEQSEHNETHE--EEEGESDDDDTKDSNDTKDM--- 170
            :.|..|..::...|.|.|..    ..|....|:....|.:  .:|.:....||:..:..|::   
Human   198 QKACFKEEIITHEEPLFDEREQEYKSWGSFHQNPLLCTQKIIPKEEKVHKHDTQKRSFKKNLMAI 262

  Fly   171 ----------LFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLD--KSASERNS----KKRKGPP 219
                      |.:|:.|::.::...||..|:|:...|.....::  |:.|:|::    ::.....
Human   263 KPKSVCAEKKLLKCNDCEKVFSQSSSLTLHQRIHTGEKPYKCIECGKAFSQRSNLVQHQRIHTGE 327

  Fly   220 KVYKCNEEACNQTFRTERDLRGHRWKHTG---IFCDICGKPFTQSGNMMRHRQRHSGIKPHKCPE 281
            |.|:|.|  |.:.|.....|..|...|||   ..|.:|.|.|:|...:.:|::.|:|.||::|.|
Human   328 KPYECKE--CRKAFSQNAHLVQHLRVHTGEKPYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIE 390

  Fly   282 CDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAF---- 342
            |...|..:..::.|...|||..|..|.|||:....|..||.|.|.||||||.:|:.|||||    
Human   391 CGKAFSNRSSIAQHQRVHTGEKPYECNVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNS 455

  Fly   343 --------------YSFHD----------LNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLH 383
                          |...:          |..|...||..:|:.|..||..|....:|..|:.:|
Human   456 HLAQHQRIHTGEKPYKCQECRKAFSQIAYLAQHQRVHTGEKPYECIECGKAFSNDSSLTQHQRVH 520

  Fly   384 SEQRKYACKLCGKTFAQSGGLNAHMRSHD---PARVKGAVKPLPQSV------TIEVIEGKSPP 438
            :.::.|.|.:|||.|:..|.|..|.|.|.   |...|...|...|..      .|.:.|..|||
Human   521 TGEKPYECTVCGKAFSYCGSLAQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPP 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/21 (29%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 63/189 (33%)
zf-H2C2_2 263..288 CDD:290200 9/24 (38%)
C2H2 Zn finger 279..327 CDD:275368 18/47 (38%)
zf-H2C2_2 320..342 CDD:290200 14/21 (67%)
C2H2 Zn finger 335..355 CDD:275368 9/47 (19%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-C2H2 389..411 CDD:278523 10/21 (48%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
ZNF570NP_001287922.1 KRAB 70..130 CDD:214630
C2H2 Zn finger 276..296 CDD:275368 6/19 (32%)
zf-H2C2_2 288..313 CDD:316026 6/24 (25%)
C2H2 Zn finger 304..324 CDD:275368 3/19 (16%)
COG5048 <307..572 CDD:227381 82/266 (31%)
C2H2 Zn finger 332..352 CDD:275368 6/21 (29%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
C2H2 Zn finger 416..436 CDD:275368 9/19 (47%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
C2H2 Zn finger 472..492 CDD:275368 2/19 (11%)
C2H2 Zn finger 500..520 CDD:275368 6/19 (32%)
C2H2 Zn finger 528..548 CDD:275368 9/19 (47%)
C2H2 Zn finger 556..576 CDD:275368 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.