DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and Zfp358

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_536709.2 Gene:Zfp358 / 140482 MGIID:2153740 Length:571 Species:Mus musculus


Alignment Length:422 Identity:118/422 - (27%)
Similarity:162/422 - (38%) Gaps:72/422 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PEHFRLK----HFTNSSSSLCSNELESDPIAQ---------DVVEVQGNEELHEELAKEA----- 93
            |.|..|:    ...:....|.|:..:.|||::         :.|...|:..| |:|..||     
Mouse    10 PGHKNLRPLYGDLHSDPEDLDSSPKDPDPISESPEPEPEDLNTVSEDGDASL-EDLDPEADEAPR 73

  Fly    94 ----SPDLEEEEEEKEEGSKRQHYQRAAAMKNTLVETREDLLDIELDWTGGEQSEHNETHEEEEG 154
                .|||:.::.:....|..                    ||.:.|..|......:.:::....
Mouse    74 SILGKPDLDSQDLDPMSSSFD--------------------LDPDPDVIGPVPLVLDPSNDTPSP 118

  Fly   155 ESDDDDTKDS--NDTKDML----------------FQCDQCDRAYNTKRSLQSHRRLKHSEAN-- 199
            .:.|.|:..|  ..|.::|                |.|..|.||:.....|..|||....|..  
Mouse   119 AAPDVDSLPSGLTATPEILATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYR 183

  Fly   200 ----GGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTG---IFCDICGKP 257
                |.|....|:....:......:.|:|  .||.:.|.....|..||..|:|   ..|.:|||.
Mouse   184 CPDCGKSFSHGATLAQHRGIHTGARPYQC--AACGKAFGWRSTLLKHRSSHSGEKPHHCPVCGKA 246

  Fly   258 FTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTA 322
            |.....:.:|.:.|.|.:|||||.|...|.....|..|...|||..|..|..||:.......|..
Mouse   247 FGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQ 311

  Fly   323 HMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQR 387
            |.|.||.|||.:|..|||||....:|..|...||..||:.|..|...|.:..||..|..:||.:|
Mouse   312 HQRTHTAERPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHVHSGER 376

  Fly   388 KYACKLCGKTFAQSGGLNAHMRSHDPARVKGA 419
            .|.|:||||.|.|:..|..|.|.|:.|....|
Mouse   377 PYRCQLCGKAFGQASSLTKHKRVHEGAAAAAA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 62/158 (39%)
zf-H2C2_2 263..288 CDD:290200 10/24 (42%)
C2H2 Zn finger 279..327 CDD:275368 16/47 (34%)
zf-H2C2_2 320..342 CDD:290200 12/21 (57%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-C2H2 389..411 CDD:278523 11/21 (52%)
C2H2 Zn finger 391..411 CDD:275368 10/19 (53%)
Zfp358NP_536709.2 zf-C2H2 154..176 CDD:278523 9/21 (43%)
C2H2 Zn finger 156..176 CDD:275368 8/19 (42%)
zf-H2C2_2 169..193 CDD:290200 7/23 (30%)
C2H2 Zn finger 184..204 CDD:275368 3/19 (16%)
zf-H2C2_2 197..219 CDD:290200 4/23 (17%)
C2H2 Zn finger 212..232 CDD:275368 7/21 (33%)
zf-H2C2_2 225..247 CDD:290200 9/21 (43%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-H2C2_2 253..275 CDD:290200 9/21 (43%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
zf-H2C2_2 280..303 CDD:290200 9/22 (41%)
zf-C2H2_8 295..373 CDD:292531 29/77 (38%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
zf-H2C2_2 308..331 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 336..359 CDD:290200 8/22 (36%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 364..387 CDD:290200 12/22 (55%)
zf-C2H2 378..400 CDD:278523 11/21 (52%)
C2H2 Zn finger 380..400 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.