DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and CMR3

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_015338.1 Gene:CMR3 / 856123 SGDID:S000006217 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:45/182 - (24%)
Similarity:68/182 - (37%) Gaps:47/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DEETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHC 206
            |:|.|....:|:..:.|.:.:...|||  |..:.|:...|.                        
Yeast   171 DKEPITIASEPNFTAISMASHPNAALE--LCHDRPKSVPPG------------------------ 209

  Fly   207 DRRY----TTQKYLNTHLKMSHPFPQAFKCVDCKATFD---VDRALAQHR-RKEHTEFACQLCDK 263
               |    |.|:..|...|..   |.|  .::..|||.   .|..::..: ||:     |.:|.|
Yeast   210 ---YGVLPTMQEASNGRTKSE---PGA--VLNGSATFSDWKTDTRISSTKLRKQ-----CPVCGK 261

  Fly   264 VFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYV 315
            :.....:|..|...|:|...|||..|.|.|||..:.|:..|.:.|..:||.|
Yeast   262 ICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNKV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 6/24 (25%)
COG5048 <258..416 CDD:227381 21/58 (36%)
C2H2 Zn finger 258..278 CDD:275368 5/19 (26%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 316..336 CDD:275368 45/182 (25%)
zf-H2C2_2 328..353 CDD:290200
C2H2 Zn finger 344..364 CDD:275368
zf-H2C2_2 357..381 CDD:290200
C2H2 Zn finger 372..392 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
CMR3NP_015338.1 COG5048 17..316 CDD:227381 45/182 (25%)
C2H2 Zn finger 256..276 CDD:275370 5/19 (26%)
C2H2 Zn finger 284..306 CDD:275370 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.