DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and AT5G61470

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_200955.1 Gene:AT5G61470 / 836268 AraportID:AT5G61470 Length:304 Species:Arabidopsis thaliana


Alignment Length:274 Identity:50/274 - (18%)
Similarity:91/274 - (33%) Gaps:112/274 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DSFKKEYLPN----EDVLS--EEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDHD 155
            |....|||.|    :.::|  :.:|.|..:.::.||.:         :.|.||..::...:.:.|
plant   129 DDNMSEYLQNLKSIDSLVSTRKRKDTENYIEIDSDENH---------EDSDDEYVVEDEDEDNED 184

  Fly   156 SSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHL 220
            ....|:...  :|.|:|..:..|   |:.|:|:.....|::                        
plant   185 DDVKSLTSD--VENLIGDSDEDD---DDYGDENAYYGGKRK------------------------ 220

  Fly   221 KMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFACQLCDKVFKSSRSLLRHVQGHSGARTFK 285
                                        |.|:.:::.|..|.||.:|.::|..|...|       
plant   221 ----------------------------RGKKQSKYTCDTCGKVLRSYQALGGHRTSH------- 250

  Fly   286 CEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARR 350
                             .::|:...::||..|         :..||.|:       ::||.|.|.
plant   251 -----------------KYKRLKISDKNYFGE---------DGPIVRRQ-------YECQICNRM 282

  Fly   351 FASKSLLNEHQAMH 364
            |||...|..|:.:|
plant   283 FASGQALGGHKKIH 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 2/20 (10%)
COG5048 <258..416 CDD:227381 25/107 (23%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..308 CDD:275368 1/18 (6%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..353 CDD:290200 8/24 (33%)
C2H2 Zn finger 344..364 CDD:275368 9/19 (47%)
zf-H2C2_2 357..381 CDD:290200 3/8 (38%)
C2H2 Zn finger 372..392 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
AT5G61470NP_200955.1 zf-C2H2_6 10..31 CDD:290623
zf-C2H2_6 228..251 CDD:290623 8/46 (17%)
C2H2 Zn finger 230..250 CDD:275368 7/19 (37%)
zf-C2H2_6 274..297 CDD:290623 10/23 (43%)
C2H2 Zn finger 276..296 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.