Sequence 1: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001342539.1 | Gene: | Zbtb43 / 71834 | MGIID: | 1919084 | Length: | 504 | Species: | Mus musculus |
Alignment Length: | 355 | Identity: | 76/355 - (21%) |
---|---|---|---|
Similarity: | 117/355 - (32%) | Gaps: | 122/355 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 EGNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDY---QPDEDGEE 187
Fly 188 HQ---------SVFKKQRQPKDYNCPHCDR--------------------RYTTQKY----LNTH 219
Fly 220 LKMSHPFP----QAFKCVDCKATFD-------VDRALAQH--------------RRKEHTEFACQ 259
Fly 260 LCDKVF-----------------KSSRSLLRHVQ----------------------GHSG----A 281
Fly 282 RTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQT 346
Fly 347 CARRFASKSLLNEHQAMHSTEKPYKCDKCD 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 6/41 (15%) |
COG5048 | <258..416 | CDD:227381 | 37/162 (23%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 5/58 (9%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 357..381 | CDD:290200 | 5/20 (25%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 1/5 (20%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | |||
Zbtb43 | NP_001342539.1 | BTB | 60..160 | CDD:306997 | |
C2H2 Zn finger | 413..431 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 439..459 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 451..474 | CDD:316026 | 10/22 (45%) | ||
C2H2 Zn finger | 467..484 | CDD:275368 | 6/18 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |