DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and Zbtb7c

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001120847.1 Gene:Zbtb7c / 679155 RGDID:1591841 Length:619 Species:Rattus norvegicus


Alignment Length:267 Identity:64/267 - (23%)
Similarity:94/267 - (35%) Gaps:102/267 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 ENPQDYQP-----------DEDGEE--------HQSVFKKQRQP-------------KDYNCPHC 206
            |.|.|..|           :|:.||        ..|.|.|...|             .||..   
  Rat   272 EQPMDSGPLDLVIKDRKIKEEEKEELAPPPPPPFSSDFFKDMFPDLPGGPLGPIKAENDYGA--- 333

  Fly   207 DRRYTTQKYLN----THL-KMSHPFPQAFKCVDCKATFDVDRALAQHRR-KEHTEFACQLCDKVF 265
                    |||    ||| .:..|:|                 |.:.|: |......|.:|.||.
  Rat   334 --------YLNFLSATHLGSLFPPWP-----------------LVEERKLKPKASQQCPICHKVI 373

  Fly   266 KSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALI 330
            ..:..|.||::.|:|                              |:.|:|.:|..|...::.|.
  Rat   374 MGAGKLPRHMRTHTG------------------------------EKPYMCSICEVRFTRQDKLK 408

  Fly   331 VHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGI 395
            :|.|.||||:|:.|..|..:|.....|..|..:|:..:||:|:.|..:|:|      ..|||..|
  Rat   409 IHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTR------SDHLHRHI 467

  Fly   396 KKFKCKI 402
            |:..|::
  Rat   468 KRQSCRM 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 3/21 (14%)
COG5048 <258..416 CDD:227381 40/145 (28%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..308 CDD:275368 0/18 (0%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 11/24 (46%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 8/23 (35%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
C2H2 Zn finger 400..420 CDD:275368 1/3 (33%)
Zbtb7cNP_001120847.1 BTB_POZ_ZBTB7C_ZBTB36 9..128 CDD:349637
C2H2 Zn finger 366..386 CDD:275368 7/19 (37%)
SFP1 <380..468 CDD:227516 32/123 (26%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..442 CDD:275368 5/19 (26%)
C2H2 Zn finger 450..468 CDD:275368 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.