| Sequence 1: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_849253.2 | Gene: | Hic2 / 58180 | MGIID: | 1929869 | Length: | 619 | Species: | Mus musculus |
| Alignment Length: | 386 | Identity: | 89/386 - (23%) |
|---|---|---|---|
| Similarity: | 131/386 - (33%) | Gaps: | 121/386 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 117 EQELGLEQDEGNPLRIMVLGGKQSVDEETI---DTMWQPDHDSSSASV---NEGCALEALLGVEN 175
Fly 176 PQDYQPDEDGEEHQSVFKKQ-RQP----------KDYN--------------------CPHCDRR 209
Fly 210 YTTQKYLNTHLKMS------------HPFPQAFKCVDCKATFDVDRALAQHRRKEHTE------- 255
Fly 256 -------------------FACQLCDKVFKSSRSLLRHVQGH----------------SG----- 280
Fly 281 --------------ARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIV 331
Fly 332 HRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLH 392 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 2/20 (10%) |
| COG5048 | <258..416 | CDD:227381 | 52/170 (31%) | ||
| C2H2 Zn finger | 258..278 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 289..308 | CDD:275368 | 4/18 (22%) | ||
| C2H2 Zn finger | 316..336 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 328..353 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 344..364 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 357..381 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 372..392 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 400..420 | CDD:275368 | |||
| Hic2 | NP_849253.2 | BTB | 40..140 | CDD:279045 | |
| BTB | 47..141 | CDD:197585 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 180..293 | 11/51 (22%) | |||
| Binding to CtBP. /evidence=ECO:0000250 | 247..249 | 0/1 (0%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 307..426 | 22/127 (17%) | |||
| C2H2 Zn finger | 448..468 | CDD:275368 | 9/19 (47%) | ||
| zf-C2H2 | 509..531 | CDD:278523 | 7/23 (30%) | ||
| C2H2 Zn finger | 511..531 | CDD:275368 | 5/21 (24%) | ||
| zf-C2H2 | 537..559 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 539..559 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 552..576 | CDD:290200 | 11/23 (48%) | ||
| COG5048 | 563..>617 | CDD:227381 | 22/53 (42%) | ||
| C2H2 Zn finger | 567..587 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 580..604 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 595..615 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||