DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and zbtb20

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_021331970.1 Gene:zbtb20 / 568779 ZFINID:ZDB-GENE-070112-1992 Length:707 Species:Danio rerio


Alignment Length:421 Identity:89/421 - (21%)
Similarity:140/421 - (33%) Gaps:130/421 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HCLANVDYVRLHAQQQLRPKCGEIFYEPEANRFQLVCLLCDMKHFGFEDFARHIRNVHFDKQGRP 68
            ||......||||.        |:|..:.|...        :...:|.||..         :.|.|
Zfish   263 HCRKQPRPVRLHP--------GDIHIKQEQGD--------EFNCYGIEDCR---------EDGEP 302

  Fly    69 LTKTVTGLGRLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSEEEDAEQEL---------GLEQ 124
            |                 :.|.:||.. :||....  :..:.:|.:..||..         |.:.
Zfish   303 L-----------------ECVESEPKG-ESFDSGV--SSSIGTETDSVEQPFLSGFNCPSKGQQG 347

  Fly   125 DEGNPLRIMVLGGKQSVDEETIDTMW--QPDHDSSSASVNE------------------------ 163
            :.|.|::|.|........:|.|:...  .|..:|....:::                        
Zfish   348 ERGTPVQIEVNDSSPEQTQEIIEDSSGNGPTQESGEIGIHQANLTAPQVMPGGPYLRPGEPLTSN 412

  Fly   164 --------------GCA----LEALLGVENPQDYQP-----DEDGEEHQSVFKKQRQPKDYNCPH 205
                          |.|    |..|...::..|.:|     .:.....|..|.....|   |.| 
Zfish   413 LRMPLTLTSNSQVMGTAGNTYLPTLFATQSASDNKPFLFSLPQSIGSQQPQFVAVPSP---NMP- 473

  Fly   206 CDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFACQLCDKVFKSSRS 270
                               |||.........:.........||..|:  .:||.||.|.|.:.::
Zfish   474 -------------------PFPGGLSVPPGGSQQQGGAPGGQHGEKK--PYACTLCCKTFTAKQN 517

  Fly   271 LLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRT 335
            .::|:..|:|.:..:|  ..|.:||..:..|..|...|:..|.|.|.:|..|...:.:|.||.|.
Zfish   518 YVKHMFVHTGEKPHQC--SICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRL 580

  Fly   336 HTGEKPFQCQTCARRFASKSLLNEHQAMHST 366
            |.|||.::|..|.::|:.|:||..|.|:|||
Zfish   581 HRGEKSYECYICKKKFSHKTLLERHMALHST 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 3/20 (15%)
COG5048 <258..416 CDD:227381 39/109 (36%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 11/24 (46%)
C2H2 Zn finger 344..364 CDD:275368 8/19 (42%)
zf-H2C2_2 357..381 CDD:290200 6/10 (60%)
C2H2 Zn finger 372..392 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
zbtb20XP_021331970.1 BTB 41..143 CDD:306997
C2H2 Zn finger 505..525 CDD:275368 6/19 (32%)
zf-C2H2 531..553 CDD:306579 6/23 (26%)
C2H2 Zn finger 533..553 CDD:275368 6/21 (29%)
zf-H2C2_2 545..570 CDD:316026 8/24 (33%)
zf-C2H2 559..581 CDD:306579 8/21 (38%)
C2H2 Zn finger 561..581 CDD:275368 7/19 (37%)
zf-H2C2_2 573..598 CDD:316026 11/24 (46%)
C2H2 Zn finger 589..609 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.