DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and plag1

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001034903.1 Gene:plag1 / 561450 ZFINID:ZDB-GENE-060302-2 Length:393 Species:Danio rerio


Alignment Length:247 Identity:67/247 - (27%)
Similarity:103/247 - (41%) Gaps:46/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DCKATFDVDRALAQHRRKE---HTEFACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSF 295
            ||...  .|....:.||:|   ...|:||||:|.|.|...|..|...|:|.|.:.|.|.:|.|:|
Zfish     8 DCPTV--ADHCRVRKRREEGKVRKNFSCQLCEKAFNSLEKLKVHSYSHTGERPYHCTHTDCTKAF 70

  Fly   296 VNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEK-PFQCQTCARRFASKSLLNE 359
            |:::.|..|...||.|:.:.|..|......::.|..|..||...| .|.|..|.:.:.:|.....
Zfish    71 VSKYKLLRHMATHSPEKTHKCSYCEKMFHRKDHLKNHLHTHDPNKEAFSCTECDKSYNTKLGFRR 135

  Fly   360 HQAMHST------------------------------------EKPYKCDKCDSAFSRPKALYHH 388
            |||:|:.                                    ||.::||:|:..|...|.:..|
Zfish   136 HQALHAAQRGDLTCQVCLQSYPSTPLLLEHLRGHAGKSATATKEKRHQCDQCERRFYTRKDVRRH 200

  Fly   389 KHLHLGIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEGAEAEPIEML 440
            ..:|.|.|.|.|:.|    ||..|...|:..|..::..:.....:|||::::
Zfish   201 LVVHTGRKDFLCQYC----AQRFGRKDHLTRHVKKSHAHELLRVKAEPVDLM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 6/21 (29%)
COG5048 <258..416 CDD:227381 55/194 (28%)
C2H2 Zn finger 258..278 CDD:275368 9/19 (47%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..353 CDD:290200 8/25 (32%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 10/59 (17%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
plag1NP_001034903.1 COG5048 29..>99 CDD:227381 26/69 (38%)
C2H2 Zn finger 33..53 CDD:275368 9/19 (47%)
C2H2 Zn finger 61..83 CDD:275368 8/21 (38%)
zf-H2C2_2 76..100 CDD:290200 7/23 (30%)
C2H2 Zn finger 91..111 CDD:275368 4/19 (21%)
C2H2 Zn finger 120..140 CDD:275368 6/19 (32%)
C2H2 Zn finger 149..169 CDD:275368 0/19 (0%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..230 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.