DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and PLAG1

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001108106.1 Gene:PLAG1 / 5324 HGNCID:9045 Length:500 Species:Homo sapiens


Alignment Length:252 Identity:66/252 - (26%)
Similarity:104/252 - (41%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DCKATFDVDRALAQHRRKEHTE----FACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKS 294
            |.....|..:..:..|::..|:    |.||||||.|.|...|..|...|:|.|.:||..::|.|:
Human     8 DLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKA 72

  Fly   295 FVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEK-PFQCQTCARRFASKSLLN 358
            ||:::.|..|...||.|:.:.|..|......::.|..|..||...| .|:|:.|.:.:.:|....
Human    73 FVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFK 137

  Fly   359 EHQAMHST------------------------------------EKPYKCDKCDSAFSRPKALYH 387
            .|.|:|:.                                    ||.::|:.||..|...|.:..
Human   138 RHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRR 202

  Fly   388 HKHLHLGIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEGAEAEPIEML--FT 442
            |..:|.|.|.|.|:.|...:.:...|:.||:....|..:.    .:.||::.|  ||
Human   203 HMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLK----VKTEPVDFLDPFT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 3/18 (17%)
COG5048 <258..416 CDD:227381 53/194 (27%)
C2H2 Zn finger 258..278 CDD:275368 10/19 (53%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..353 CDD:290200 8/25 (32%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 9/59 (15%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
PLAG1NP_001108106.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 4/21 (19%)
Interaction with KPNA2. /evidence=ECO:0000269|PubMed:11882654 2..84 26/75 (35%)
Nuclear localization signal 22..25 1/2 (50%)
C2H2 Zn finger 36..56 CDD:275368 10/19 (53%)
Decreased nuclear import with localization in the nucleus but also in the cytoplasm 41..242 51/200 (26%)
SFP1 <58..139 CDD:227516 24/80 (30%)
C2H2 Zn finger 64..86 CDD:275368 7/21 (33%)
zf-H2C2_2 79..103 CDD:404364 7/23 (30%)
C2H2 Zn finger 94..114 CDD:275368 4/19 (21%)
C2H2 Zn finger 123..143 CDD:275368 5/19 (26%)
C2H2 Zn finger 152..172 CDD:275368 0/19 (0%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
C2H2 Zn finger 215..233 CDD:275368 4/17 (24%)
Activates transcription, Inhibition of nuclear import due to lack of NLS and KPNA2 interaction 243..500 5/13 (38%)
Repression domain, contains 3 sumoylation motifs and massively decrease transcription activity 243..384 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..388
Massively activates transcription 385..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.