DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and PLAG1

DIOPT Version :10

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_002646.2 Gene:PLAG1 / 5324 HGNCID:9045 Length:500 Species:Homo sapiens


Alignment Length:252 Identity:66/252 - (26%)
Similarity:104/252 - (41%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DCKATFDVDRALAQHRRKEHTE----FACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKS 294
            |.....|..:..:..|::..|:    |.||||||.|.|...|..|...|:|.|.:||..::|.|:
Human     8 DLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKA 72

  Fly   295 FVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEK-PFQCQTCARRFASKSLLN 358
            ||:::.|..|...||.|:.:.|..|......::.|..|..||...| .|:|:.|.:.:.:|....
Human    73 FVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFK 137

  Fly   359 EHQAMHST------------------------------------EKPYKCDKCDSAFSRPKALYH 387
            .|.|:|:.                                    ||.::|:.||..|...|.:..
Human   138 RHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRR 202

  Fly   388 HKHLHLGIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEGAEAEPIEML--FT 442
            |..:|.|.|.|.|:.|...:.:...|:.||:....|..:.    .:.||::.|  ||
Human   203 HMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLK----VKTEPVDFLDPFT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 3/18 (17%)
COG5048 <258..416 CDD:227381 53/194 (27%)
C2H2 Zn finger 258..278 CDD:275368 10/19 (53%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
PLAG1NP_002646.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 4/21 (19%)
Interaction with KPNA2. /evidence=ECO:0000269|PubMed:11882654 2..84 26/75 (35%)
Nuclear localization signal 22..25 1/2 (50%)
C2H2 Zn finger 36..56 CDD:275368 10/19 (53%)
Decreased nuclear import with localization in the nucleus but also in the cytoplasm 41..242 51/200 (26%)
SFP1 <58..139 CDD:227516 24/80 (30%)
C2H2 Zn finger 64..86 CDD:275368 7/21 (33%)
zf-H2C2_2 79..101 CDD:463886 7/21 (33%)
C2H2 Zn finger 94..114 CDD:275368 4/19 (21%)
C2H2 Zn finger 123..143 CDD:275368 5/19 (26%)
C2H2 Zn finger 152..172 CDD:275368 0/19 (0%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
C2H2 Zn finger 215..233 CDD:275368 4/17 (24%)
Activates transcription, Inhibition of nuclear import due to lack of NLS and KPNA2 interaction 243..500 5/13 (38%)
Repression domain, contains 3 sumoylation motifs and massively decrease transcription activity 243..384 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..388
Massively activates transcription 385..500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.