DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and MTF1

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_005946.2 Gene:MTF1 / 4520 HGNCID:7428 Length:753 Species:Homo sapiens


Alignment Length:354 Identity:91/354 - (25%)
Similarity:153/354 - (43%) Gaps:78/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 EYLPNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCA 166
            |:.|:.:::..|        .|:||..|...|:    :.||:..:       ..|||.:|.:   
Human     3 EHSPDNNIIYFE--------AEEDELTPDDKML----RFVDKNGL-------VPSSSGTVYD--- 45

  Fly   167 LEALLGVENPQDYQPDED-------------GEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYL-- 216
            ...:|..::|...:.::|             |||...:.              |....:|.|:  
Human    46 RTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLI--------------DHEAMSQGYVQH 96

  Fly   217 -----NTHLKM---SHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFACQL--CDKVFKSSRSL 271
                 ..||.:   |.|.|:..:    .||..:.....:.:|||...:.|..  |.:.:.::.:|
Human    97 IISPDQIHLTINPGSTPMPRNIE----GATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNL 157

  Fly   272 LRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCG----YRSRYREALIVH 332
            ..|.:.|.|..||.|..|.|||:|:..::|..|.|||::|:.:.|::.|    :.:.||  |..|
Human   158 RTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYR--LKAH 220

  Fly   333 RRTHTGEKPFQCQT--CARRFASKSLLNEHQAMHSTEKPYKCDK--CDSAFSRPKALYHHKHLHL 393
            :|.||| |.|.|::  |::.|.:.|.|.:|...|:.|||::||.  |..||:....|..|...|.
Human   221 QRLHTG-KTFNCESEGCSKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHT 284

  Fly   394 GIKKFKCKI--CGNAYAQAAGLSAHMRAH 420
            |.:.|.|..  |...::....|.:||:.|
Human   285 GERPFFCPSNGCEKTFSTQYSLKSHMKGH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 4/20 (20%)
COG5048 <258..416 CDD:227381 55/169 (33%)
C2H2 Zn finger 258..278 CDD:275368 4/21 (19%)
C2H2 Zn finger 289..308 CDD:275368 8/18 (44%)
C2H2 Zn finger 316..336 CDD:275368 7/23 (30%)
zf-H2C2_2 328..353 CDD:290200 11/26 (42%)
C2H2 Zn finger 344..364 CDD:275368 6/21 (29%)
zf-H2C2_2 357..381 CDD:290200 11/25 (44%)
C2H2 Zn finger 372..392 CDD:275368 7/21 (33%)
C2H2 Zn finger 400..420 CDD:275368 5/21 (24%)
MTF1NP_005946.2 COG5048 <93..291 CDD:227381 63/204 (31%)
Nuclear localization signal. /evidence=ECO:0000255 133..138 3/4 (75%)
C2H2 Zn finger 145..164 CDD:275368 3/18 (17%)
zf-H2C2_2 156..183 CDD:290200 12/26 (46%)
C2H2 Zn finger 172..194 CDD:275368 9/21 (43%)
zf-H2C2_2 186..213 CDD:290200 8/26 (31%)
C2H2 Zn finger 202..224 CDD:275368 7/23 (30%)
zf-C2H2_8 231..319 CDD:292531 26/83 (31%)
C2H2 Zn finger 234..253 CDD:275368 5/18 (28%)
zf-H2C2_2 245..271 CDD:290200 10/25 (40%)
C2H2 Zn finger 261..283 CDD:275368 7/21 (33%)
zf-H2C2_2 275..302 CDD:290200 7/26 (27%)
C2H2 Zn finger 291..313 CDD:275368 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..328 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 648..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.