DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and hic1

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001002314.1 Gene:hic1 / 436585 ZFINID:ZDB-GENE-040713-2 Length:737 Species:Danio rerio


Alignment Length:473 Identity:105/473 - (22%)
Similarity:164/473 - (34%) Gaps:142/473 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DFARHIRNV--H-FDKQGRPLTKTVTGLGRLAREEQEFQGVSAEPL---------AVDSFKKEYL 104
            |...|:.::  | |.....||...:..|.|...:||.....|.||:         |.:.::  ::
Zfish   281 DTGHHMGSLTPHPFPLPNHPLAPNLPHLHRSQGQEQYPCPPSPEPIEDTRDQRRDASNIYR--WV 343

  Fly   105 PNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVD------------EETIDTMWQPDHD-- 155
            .||....|:||.:.|   |.|.|..       |:|..:            ||.::|. :..:|  
Zfish   344 KNEPSNPEDEDEDDE---EDDSGGM-------GEQDKERHHQHMNHHKSNEEKLNTN-ERGYDRG 397

  Fly   156 ------------SSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDR 208
                        |.....:||.....:.|......|:|:..|:..            |.|..||:
Zfish   398 TCDDGEDENGTGSEETGSSEGRPSPPVPGGRYHMPYEPESFGDNL------------YVCIPCDK 450

  Fly   209 RYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFACQLCDKVFKSSRSLLR 273
            .:.:.:.||.|:                              :.|||.......::..|:.|..:
Zfish   451 GFPSSEQLNAHV------------------------------ETHTEEELNNGSEMDSSNNSNSK 485

  Fly   274 ----------------HVQGHSG--------------ARTFKCEHENCGKSFVNQHNLTSHRRVH 308
                            |...|.|              .|.::|  .:|.||:.:...|..|.:.|
Zfish   486 PTTVRAPTSLNSSSGLHSPYHDGKLAQNLHSIGLGEIIRPYRC--SSCDKSYKDPATLRQHEKTH 548

  Fly   309 SEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCD 373
            ...|.|.|.:||.:...|..:..|.|:|.|.|||.|..|..||..:..|.||..:||.||||:|.
Zfish   549 WLTRPYPCSICGKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQ 613

  Fly   374 KCDSAFSRPKALYHHKHLHL------GIK---KFKCKICGNAY------AQAAGLSAHMRAHKLQ 423
            .|...|::.:.|..|..:|.      |:.   |.|.......|      |:..||.....:..|.
Zfish   614 VCGGKFAQQRNLISHMKMHSSGAAGGGLTPDGKLKIDFSEGIYPLSKYTAEHLGLKQEKTSDLLA 678

  Fly   424 ASVNATEGAEAEPIEMLF 441
            ||.:..  |:|:.:|.|:
Zfish   679 ASQHLL--ADAKAMESLY 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 0/20 (0%)
COG5048 <258..416 CDD:227381 52/202 (26%)
C2H2 Zn finger 258..278 CDD:275368 3/35 (9%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 11/24 (46%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
zf-H2C2_2 357..381 CDD:290200 12/23 (52%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
C2H2 Zn finger 400..420 CDD:275368 4/25 (16%)
hic1NP_001002314.1 BTB 18..119 CDD:279045
BTB 29..119 CDD:197585
C2H2 Zn finger 445..465 CDD:275368 6/49 (12%)
C2H2 Zn finger 528..548 CDD:275368 6/21 (29%)
zf-H2C2_2 541..565 CDD:290200 8/23 (35%)
zf-C2H2 554..576 CDD:278523 7/21 (33%)
C2H2 Zn finger 556..576 CDD:275368 6/19 (32%)
zf-H2C2_2 569..593 CDD:290200 11/23 (48%)
C2H2 Zn finger 584..604 CDD:275368 7/19 (37%)
zf-H2C2_2 597..621 CDD:290200 12/23 (52%)
C2H2 Zn finger 612..632 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.