DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and ZIPIC

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:451 Identity:109/451 - (24%)
Similarity:181/451 - (40%) Gaps:114/451 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRHCLANVDYV-----------------RLHAQ----QQLRPKCGEIFYEPEANRFQLVCLLCD 44
            ::..|....:||                 |.|..    ::||.:..|:.:.|..::        |
  Fly    31 LVLQCTRGTNYVLTEESSTICKKCCEKLARYHKSIQIARKLRGEILELIHSPYMSK--------D 87

  Fly    45 MKHFGF--EDFARHIRNVHFD-------------KQGRPLTKTVTGLG----------------- 77
            .|...:  :|..|......||             ::...:..|||.:|                 
  Fly    88 HKQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQELESVGTTVTLVGPAGIVEEVAEEEHTFII 152

  Fly    78 RLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSEEEDAE--------QELGLEQDEGNPLRIMV 134
            :.:.||.||..|..| |.:|        ||.:::|||..|        :|:..|.:|.:    ::
  Fly   153 KQSEEEDEFHSVDLE-LDID--------NEIIINEEEAHEVEEVAHEIEEVAHEIEEED----LL 204

  Fly   135 LGGKQSVDEETI---DTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQR 196
            ...||...||..   |||  .|.|...    :| |:|.::.....|:...:..||...::     
  Fly   205 PHDKQEAQEEDFFKEDTM--SDFDEHL----DG-AIEYIISDGEDQEQDNESSGEYTVNI----- 257

  Fly   197 QPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEH--TEFACQ 259
                 .||.|..::::::..|.|.|..| || .:.|..|..|.........|.:...  .:|||.
  Fly   258 -----QCPSCPEKFSSRRAYNVHTKREH-FP-GYVCDQCGKTLQSYSGFIGHLQNHEPVKQFACP 315

  Fly   260 LCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVH-SEERNYVCELCGYRS 323
            :|.:.|.....|..|:..|||...::|  :.|.|.||::..|..|:.:| ||.:...|::||:::
  Fly   316 VCPERFSRKFRLKHHMAWHSGETPYQC--DVCSKRFVHKVALYKHKMIHDSETKRLECQVCGFKT 378

  Fly   324 RYREALIVHRRTHTGEKPFQCQTCARRFAS----KSLLNEHQAMHST-EKPYKCDKCDSAF 379
            |.:..|..|.|:|||:|||.|..|.:||:.    |:.|.||::..:. .:.:.|.||...|
  Fly   379 RTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLREHESPGTNRHRRFHCSKCTHTF 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 4/20 (20%)
COG5048 <258..416 CDD:227381 43/128 (34%)
C2H2 Zn finger 258..278 CDD:275368 5/19 (26%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 13/24 (54%)
C2H2 Zn finger 344..364 CDD:275368 8/23 (35%)
zf-H2C2_2 357..381 CDD:290200 7/24 (29%)
C2H2 Zn finger 372..392 CDD:275368 4/8 (50%)
C2H2 Zn finger 400..420 CDD:275368
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
zf-H2C2_2 327..351 CDD:290200 9/25 (36%)
C2H2 Zn finger 342..391 CDD:275368 17/50 (34%)
zf-H2C2_2 383..408 CDD:290200 13/24 (54%)
C2H2 Zn finger 399..419 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..449 CDD:275368 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.