DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and CG31388

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:308 Identity:79/308 - (25%)
Similarity:124/308 - (40%) Gaps:50/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 EYL-PNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGC 165
            ||: ..:.|.|.:  :..||..:....|....|.|..:...:.|.||     :.|:||:.....|
  Fly   143 EYMNAYQSVASPQ--SSPELSTDSQLSNEHFDMGLSPESEPESEAID-----NRDTSSSHTCSKC 200

  Fly   166 ALEALLGVENP----------QDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHL 220
            .||    .||.          .|..||                ..:.|.|||..:.:...|..|.
  Fly   201 GLE----FENVDELKLHKYHLHDIPPD----------------TKFVCDHCDEGFRSAAALTRHC 245

  Fly   221 KMSHPFPQAFKCVDCKATFDVDRALAQHR----RKEHTEFACQLCDKVFKSSRSLLRHVQGHSGA 281
            .|.: .|....|..||:.|.....|..|:    |...::..|.:|.|...::.:|..|:..|:|.
  Fly   246 NMIN-LPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGT 309

  Fly   282 RTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCEL-CGYRSRYREALIVHRRTH--TGEKPFQ 343
            |..||  :.|..||.....|.||::.|:.||.|:|.. ||...|:..|..:|.|.|  ..::.:|
  Fly   310 RRHKC--DQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQ 372

  Fly   344 CQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHL 391
            |:.|.:.:.:.|....||..|:..:.:.|:.|..:|...|  ::..||
  Fly   373 CEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAK--HYRSHL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 7/24 (29%)
COG5048 <258..416 CDD:227381 41/137 (30%)
C2H2 Zn finger 258..278 CDD:275368 5/19 (26%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 7/20 (35%)
zf-H2C2_2 328..353 CDD:290200 7/26 (27%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 6/23 (26%)
C2H2 Zn finger 372..392 CDD:275368 6/20 (30%)
C2H2 Zn finger 400..420 CDD:275368
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 8/26 (31%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 7/21 (33%)
C2H2 Zn finger 342..363 CDD:275368 7/20 (35%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.