DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and nom

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:463 Identity:94/463 - (20%)
Similarity:149/463 - (32%) Gaps:172/463 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDYVRLHAQQQLRPKCGEIF---YEPEANRFQL---------------VCLLCDMKHFGFEDFAR 55
            ::..|:..:.:|.||..|:|   .:....|.||               ||..|.........|.|
  Fly     3 INVCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRR 67

  Fly    56 H--------IRNVHFDKQGR----------PLTKTVTGLGRLAREEQEFQGVSAEPLAVDSFKKE 102
            .        :..:..||.|.          |.||..|...|..|...        ||.:...   
  Fly    68 QCILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRM--------PLEIVDI--- 121

  Fly   103 YLPNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCAL 167
            .:.||...|..|.                   :||.:.  ::.::...:||...|..::.|    
  Fly   122 VVTNESKASAGES-------------------VGGDEF--DQPVEISNEPDATDSDVNLEE---- 161

  Fly   168 EALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKC 232
                 ::     .|||||.|           .|::.|            |..:            
  Fly   162 -----ID-----LPDEDGLE-----------SDHDLP------------NVQI------------ 181

  Fly   233 VDCKATFDVDRALAQHRRKEHTEFACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVN 297
                           |:        |..|..:..:..||:||...|:|.|.:.|  :.|.|:|:.
  Fly   182 ---------------HK--------CDTCGIIKNNKSSLVRHQFEHNGIRPYPC--KECPKTFLV 221

  Fly   298 QHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQA 362
            ...|.:|...|                           ||.|.||.|:.|.||:.|.....:|:.
  Fly   222 ASELKAHNLTH---------------------------HTLEPPFACRYCDRRYFSVVGRKKHER 259

  Fly   363 MHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQAAGLSAHM--RAHKLQAS 425
            :|:.|:|:.||:|..||:|...|..|..:|..::|:.|.:|..:::....|:.|.  ..||..|.
  Fly   260 VHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNAE 324

  Fly   426 VNATEGAE 433
            . .|..:|
  Fly   325 A-VTSSSE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 1/20 (5%)
COG5048 <258..416 CDD:227381 43/157 (27%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 316..336 CDD:275368 0/19 (0%)
zf-H2C2_2 328..353 CDD:290200 9/24 (38%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 9/23 (39%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
C2H2 Zn finger 400..420 CDD:275368 4/21 (19%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 14/70 (20%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 18/77 (23%)
zf-H2C2_2 255..278 CDD:290200 9/22 (41%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 6/22 (27%)
C2H2 Zn finger 297..313 CDD:275368 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.