DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and CG14655

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:268 Identity:69/268 - (25%)
Similarity:106/268 - (39%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 ENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSH------------PF 226
            :.||..:||::               .|.|..|.:.:..:..|..|||:.|            |.
  Fly   145 KEPQQKEPDQE---------------PYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPN 194

  Fly   227 PQAFKCVDCKATFDVDRALAQHRRKEHTE---------FACQLCDK-VFKSSRSLLRHVQG--HS 279
            |.........|.....: |:...|..|||         ..|..... ....:.|:|:....  .|
  Fly   195 PSPTPASTTSAVTATPK-LSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPES 258

  Fly   280 GARTFKC-EHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQ 343
            |..|.|. |.:.|.|||..::.|..|:|:|:.|..|.||:|.....::::...|...|:..||..
  Fly   259 GTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHV 323

  Fly   344 CQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYA 408
            |..|.|.|...|.|:.||.:||.|||:||:.|...|.:..:...|..:|.|:..:||::|...:.
  Fly   324 CGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFR 388

  Fly   409 QAAGLSAH 416
            .......|
  Fly   389 YKVSQRTH 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 3/20 (15%)
COG5048 <258..416 CDD:227381 48/161 (30%)
C2H2 Zn finger 258..278 CDD:275368 3/22 (14%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..353 CDD:290200 8/24 (33%)
C2H2 Zn finger 344..364 CDD:275368 8/19 (42%)
zf-H2C2_2 357..381 CDD:290200 12/23 (52%)
C2H2 Zn finger 372..392 CDD:275368 4/19 (21%)
C2H2 Zn finger 400..420 CDD:275368 3/17 (18%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 9/22 (41%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 4/19 (21%)
zf-H2C2_2 364..389 CDD:290200 6/24 (25%)
C2H2 Zn finger 380..396 CDD:275368 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.