Sequence 1: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524221.1 | Gene: | hkb / 40549 | FlyBaseID: | FBgn0261434 | Length: | 297 | Species: | Drosophila melanogaster |
Alignment Length: | 258 | Identity: | 63/258 - (24%) |
---|---|---|---|
Similarity: | 94/258 - (36%) | Gaps: | 76/258 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 KQSVDEETIDTMWQPD---HD------------SSSASVNEGCALEALLGVENPQDYQPDEDGEE 187
Fly 188 HQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMS--------H-PFPQAFKCVDCKAT----- 238
Fly 239 ----------FDVD------------RALAQ--------HRRKEHTEFACQLCDKVFKSSRSLLR 273
Fly 274 HVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTH 336 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 6/55 (11%) |
COG5048 | <258..416 | CDD:227381 | 31/79 (39%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 8/18 (44%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 4/9 (44%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | |||
zf-H2C2_2 | 357..381 | CDD:290200 | |||
C2H2 Zn finger | 372..392 | CDD:275368 | |||
C2H2 Zn finger | 400..420 | CDD:275368 | |||
hkb | NP_524221.1 | COG5048 | 195..>261 | CDD:227381 | 27/65 (42%) |
zf-C2H2 | 195..217 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 197..217 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 210..236 | CDD:290200 | 12/25 (48%) | ||
C2H2 Zn finger | 225..247 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 239..264 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 255..275 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I1809 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |