DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and hkb

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster


Alignment Length:258 Identity:63/258 - (24%)
Similarity:94/258 - (36%) Gaps:76/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 KQSVDEETIDTMWQPD---HD------------SSSASVNEGCALEALLGVENPQDYQPDEDGEE 187
            ||..:..||.|.....   ||            |||::.::.|..|||                 
  Fly    35 KQEPEAITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEAL----------------- 82

  Fly   188 HQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMS--------H-PFPQAFKCVDCKAT----- 238
            :.|.:.:...|.....||....:.....|:||...:        | ||..|...:...|.     
  Fly    83 NHSSYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAA 147

  Fly   239 ----------FDVD------------RALAQ--------HRRKEHTEFACQLCDKVFKSSRSLLR 273
                      |.:|            |.:|:        .|::...:|.|..||..|.::..|..
  Fly   148 AASTPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKG 212

  Fly   274 HVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTH 336
            |::.|:|.|.|||:...|||:|.....||.|:|:|:..|.|.|..||.:...|:.|..|.:||
  Fly   213 HIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 6/55 (11%)
COG5048 <258..416 CDD:227381 31/79 (39%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 8/18 (44%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 4/9 (44%)
C2H2 Zn finger 344..364 CDD:275368
zf-H2C2_2 357..381 CDD:290200
C2H2 Zn finger 372..392 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
hkbNP_524221.1 COG5048 195..>261 CDD:227381 27/65 (42%)
zf-C2H2 195..217 CDD:278523 7/21 (33%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 210..236 CDD:290200 12/25 (48%)
C2H2 Zn finger 225..247 CDD:275368 9/21 (43%)
zf-H2C2_2 239..264 CDD:290200 10/24 (42%)
C2H2 Zn finger 255..275 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.