DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and sug

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster


Alignment Length:244 Identity:67/244 - (27%)
Similarity:97/244 - (39%) Gaps:64/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 QSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEH 253
            |||..|.|..:|..|                 :....||...|  .|.::.:...|         
  Fly    89 QSVIMKARGQQDELC-----------------RSPVEFPDDSK--SCSSSSECGTA--------- 125

  Fly   254 TEFACQL--CDKVFKSSRSLLRHV-QGHSGAR----TFKCEHENCGKSFVNQHNLTSHRRVHSEE 311
            ::|.|..  ||:||.:..:|.:|| |.|:.|.    .:.|....|.:|                |
  Fly   126 SDFVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRS----------------E 174

  Fly   312 RNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKC--DK 374
            |       |:.:||:  ::||.||||.|||.:|..|.:.|:....|..|...||.||||||  :.
  Fly   175 R-------GFNARYK--MLVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEG 230

  Fly   375 CDSAFSRPKALYHHKHLHLGIKKFKCKI--CGNAYAQAAGLSAHMRAHK 421
            |..|:|.....:.|...|...|.:.||:  |...|...:.|..|::..|
  Fly   231 CQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 2/20 (10%)
COG5048 <258..416 CDD:227381 52/168 (31%)
C2H2 Zn finger 258..278 CDD:275368 9/22 (41%)
C2H2 Zn finger 289..308 CDD:275368 2/18 (11%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 12/24 (50%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 12/25 (48%)
C2H2 Zn finger 372..392 CDD:275368 5/21 (24%)
C2H2 Zn finger 400..420 CDD:275368 6/21 (29%)
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 10/44 (23%)
zf-H2C2_2 183..207 CDD:290200 12/23 (52%)
COG5048 192..>271 CDD:227381 26/78 (33%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
zf-H2C2_2 210..237 CDD:290200 12/26 (46%)
C2H2 Zn finger 226..248 CDD:275368 5/21 (24%)
C2H2 Zn finger 256..277 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.