DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and Clamp

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster


Alignment Length:468 Identity:117/468 - (25%)
Similarity:182/468 - (38%) Gaps:139/468 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GRPLTK-------TVTGLGRLAREEQEFQGVSAEPLAVDSFK----KEYLPNEDVL-------SE 112
            |.||.:       ||...||:....|. :.::|..::..|||    .:..|:..:|       ::
  Fly    88 GMPLNQGAALGIATVDAQGRIQIVNQN-KPIAANTISNISFKCDVCSDMFPHLALLNAHKRMHTD 151

  Fly   113 EEDAEQELGLEQDEGNPLRIM---------------VLGGKQSVDEETID-----TMWQPDHDS- 156
            .|..:|:....|..|:.:.::               .:|..|.|..:|::     .|.|..|:| 
  Fly   152 GEQQQQQQHNAQAGGDSIAVVSAQGLVQAQNIIGNGQMGQIQIVSSDTLEPVQQSVMQQQQHESK 216

  Fly   157 SSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTT-----QKYL 216
            :|..:|.|.::                   ..||   |::.||...|..|.:...|     |.::
  Fly   217 ASKCINCGSSM-------------------LQQS---KRKGPKQVRCESCMQAEQTAQQQQQLFV 259

  Fly   217 NTHLKMSHPF------PQA--------------------------------------FKCVDCKA 237
            ....:|:||.      |||                                      .||..|..
  Fly   260 AQDGQMAHPVQIISTTPQAQAQLQQIVAAQTGGTTPKREASSGSGHHPVKKRNSQQMTKCQKCNG 324

  Fly   238 TFDVDRALAQHRRKEH--------------TE----------FACQLCDKVFKSSRSLLRHVQGH 278
            :..|  .:.||....|              ||          |:|.:|..:|....||..|.:.|
  Fly   325 SGVV--LVGQHSHASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLH 387

  Fly   279 SGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQ 343
            ||.:.:||  ..||.:|.....|.:|.|:|:.|:.|.|:.||.:......|..|.|||:||:|:.
  Fly   388 SGEKNYKC--SICGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYV 450

  Fly   344 CQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYA 408
            |..|.:.||..:.|..|:.:|:.||||||:.|.||||:...|.:|..:|.|.|.:||:||..|:|
  Fly   451 CGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFA 515

  Fly   409 QAAGLSAHMRAHK 421
            ....|..|...|:
  Fly   516 DRFALKRHRGIHQ 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 5/20 (25%)
COG5048 <258..416 CDD:227381 61/157 (39%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 11/24 (46%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 13/23 (57%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 52/140 (37%)
C2H2 Zn finger 367..387 CDD:275368 6/19 (32%)
zf-H2C2_2 379..403 CDD:290200 10/25 (40%)
C2H2 Zn finger 395..415 CDD:275368 7/21 (33%)
zf-H2C2_2 407..432 CDD:290200 9/24 (38%)
C2H2 Zn finger 423..443 CDD:275368 6/19 (32%)
zf-H2C2_2 435..460 CDD:290200 11/24 (46%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
zf-H2C2_2 464..488 CDD:290200 13/23 (57%)
COG5048 475..>529 CDD:227381 24/54 (44%)
C2H2 Zn finger 479..499 CDD:275368 8/19 (42%)
zf-H2C2_2 491..515 CDD:290200 10/23 (43%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.