DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and mynn

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_005162831.1 Gene:mynn / 327167 ZFINID:ZDB-GENE-030131-5378 Length:823 Species:Danio rerio


Alignment Length:394 Identity:113/394 - (28%)
Similarity:167/394 - (42%) Gaps:67/394 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KQGRPLTKTVTGLGRLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSE-EEDAEQ--ELGLEQD 125
            |:|||.:|.|:               |.:|.:|.|.:   :..|:...| .:|||:  |.|.|..
Zfish   363 KRGRPRSKPVS---------------SEDPESVISVE---ISGEEAGEETSQDAEKHTEEGTEDS 409

  Fly   126 EGNP---LRI----MVLGGK----QSVDEETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDY 179
            |.||   :||    .:|..|    |:.|||..:.|     |....:.||..|.|        ::.
Zfish   410 ESNPGNSVRISKRKRILSRKLKESQAGDEEEEEEM-----DDEFENDNEDWAGE--------EEV 461

  Fly   180 QPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRA 244
            :|.:|  :|:.:           |..|...::....|..|::: |...:.::|..|..:|.....
Zfish   462 KPVQD--KHRPI-----------CNICGNLFSEMSSLRRHMRI-HKGLKPYQCTLCTRSFRQGNQ 512

  Fly   245 LAQHRRKEHT---EFACQLCDKVFKSSRSLLRHVQGHSG-ARTFKCEHENCGKSFVNQHNLTSHR 305
            |..|.| .||   .|.|..||..|.....|:.|.:.|.| .:.:|||.  ||.:|....||..|.
Zfish   513 LKTHMR-IHTGEKPFTCTSCDSRFAQKCQLVYHCRMHHGEEKPYKCEF--CGAAFATSSNLKIHI 574

  Fly   306 RVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPY 370
            |.||.|:.|.|..||.|......|:.|:|.||||||:.|.||...||..|.|..|...|:...||
Zfish   575 RKHSGEKPYECGECGKRFTQASTLMYHKRRHTGEKPYICDTCGMAFAVSSSLIAHNRKHTGVTPY 639

  Fly   371 KCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQAAGLSAH-MRAHKLQASVNATEGAEA 434
            .|..|.........|..|..:|.|.:|..|.:||..::....|..| :..|.:...:..|:.::.
Zfish   640 ICLDCGKPCLTAGELRKHMDVHNGARKVICNLCGIIFSDIYSLKKHSILKHNVVPELETTQTSKT 704

  Fly   435 EPIE 438
            :|.:
Zfish   705 DPTQ 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 6/20 (30%)
COG5048 <258..416 CDD:227381 57/158 (36%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 13/24 (54%)
C2H2 Zn finger 344..364 CDD:275368 8/19 (42%)
zf-H2C2_2 357..381 CDD:290200 7/23 (30%)
C2H2 Zn finger 372..392 CDD:275368 4/19 (21%)
C2H2 Zn finger 400..420 CDD:275368 5/20 (25%)
mynnXP_005162831.1 BTB 14..114 CDD:279045
BTB 25..113 CDD:197585
C2H2 Zn finger 472..492 CDD:275368 4/20 (20%)
zf-H2C2_2 484..509 CDD:290200 6/25 (24%)
C2H2 Zn finger 500..520 CDD:275368 6/20 (30%)
zf-H2C2_2 513..537 CDD:290200 10/24 (42%)
C2H2 Zn finger 528..548 CDD:275368 6/19 (32%)
zf-H2C2_2 541..566 CDD:290200 10/26 (38%)
zf-C2H2 555..577 CDD:278523 10/23 (43%)
C2H2 Zn finger 557..577 CDD:275368 9/21 (43%)
zf-H2C2_2 569..594 CDD:290200 12/24 (50%)
C2H2 Zn finger 585..605 CDD:275368 7/19 (37%)
zf-H2C2_2 598..621 CDD:290200 12/22 (55%)
C2H2 Zn finger 613..633 CDD:275368 8/19 (42%)
C2H2 Zn finger 641..661 CDD:275368 4/19 (21%)
C2H2 Zn finger 669..685 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.