DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and Zfp653

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001297688.1 Gene:Zfp653 / 319601 MGIID:2442362 Length:623 Species:Mus musculus


Alignment Length:257 Identity:68/257 - (26%)
Similarity:104/257 - (40%) Gaps:61/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 EETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQS------VFKKQRQPKDY 201
            ||..|:: .|:....:|:|.|....||            :.||||..|      :::..::|   
Mouse   406 EEKEDSV-APELAELAATVPENAEAEA------------EVDGEELDSSEMSAIIYEIPKEP--- 454

  Fly   202 NCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFAC--QLCDKV 264
                 ::|..:::                     ....|.|..|..        |.|  :.|.:|
Mouse   455 -----EKRRRSKR---------------------SRVMDADGLLEM--------FHCPYEGCSQV 485

  Fly   265 FKSSRSLLRHVQ-GHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREA 328
            :.:..|...||. .|...:|..|.|..|||.|...::|..|..:||..|.:.||.||...:.:..
Mouse   486 YVALSSFQNHVNLVHRKGKTKVCPHPGCGKKFYLSNHLRRHMIIHSGVREFTCETCGKSFKRKNH 550

  Fly   329 LIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYK--CDKCDSAFSRPKALYHH 388
            |.|||||||||.|.||:.|..:...::.||.|...|:.|..|.  ||:|...|.:..::..|
Mouse   551 LEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTAEVQYNFTCDRCGKRFEKLDSVKFH 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 3/20 (15%)
COG5048 <258..416 CDD:227381 48/136 (35%)
C2H2 Zn finger 258..278 CDD:275368 6/22 (27%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 9/19 (47%)
zf-H2C2_2 328..353 CDD:290200 14/24 (58%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 10/25 (40%)
C2H2 Zn finger 372..392 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..420 CDD:275368
Zfp653NP_001297688.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..235
COG5048 <494..622 CDD:227381 44/119 (37%)
C2H2 Zn finger 511..530 CDD:275368 6/18 (33%)
zf-H2C2_2 522..547 CDD:290200 9/24 (38%)
C2H2 Zn finger 538..558 CDD:275368 9/19 (47%)
zf-H2C2_2 550..575 CDD:290200 14/24 (58%)
C2H2 Zn finger 566..586 CDD:275368 5/19 (26%)
C2H2 Zn finger 596..617 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5104
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.