Sequence 1: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001297688.1 | Gene: | Zfp653 / 319601 | MGIID: | 2442362 | Length: | 623 | Species: | Mus musculus |
Alignment Length: | 257 | Identity: | 68/257 - (26%) |
---|---|---|---|
Similarity: | 104/257 - (40%) | Gaps: | 61/257 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 EETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQS------VFKKQRQPKDY 201
Fly 202 NCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFAC--QLCDKV 264
Fly 265 FKSSRSLLRHVQ-GHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREA 328
Fly 329 LIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYK--CDKCDSAFSRPKALYHH 388 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 3/20 (15%) |
COG5048 | <258..416 | CDD:227381 | 48/136 (35%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 6/22 (27%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 357..381 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | |||
Zfp653 | NP_001297688.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..46 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 93..115 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 174..235 | ||||
COG5048 | <494..622 | CDD:227381 | 44/119 (37%) | ||
C2H2 Zn finger | 511..530 | CDD:275368 | 6/18 (33%) | ||
zf-H2C2_2 | 522..547 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 538..558 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 550..575 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 566..586 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 596..617 | CDD:275368 | 5/17 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S5104 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.950 |