DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and CG32767

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster


Alignment Length:359 Identity:81/359 - (22%)
Similarity:139/359 - (38%) Gaps:54/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VSAEPLAVDSFKKEYLPNEDVLSEEED--------AEQELGLEQDEGNPLRIMVLGGKQSVDEET 145
            :|..|:.|.:..::.||...::.:.:.        |||:|.|..::....:      :|...::.
  Fly   367 ISRSPMTVLNVVQQALPATQLILQTQQQQTPAAAAAEQQLALALEQQRQQQ------EQQAQQQR 425

  Fly   146 IDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPH----- 205
            .....|...........:          :..|..|.::..::.|.:.::|:|.:.:...|     
  Fly   426 QQQQQQEQQRQQQQQQQQ----------QQQQQAQQEQQRQQQQQLQQQQQQQQTHPVKHSASGS 480

  Fly   206 --CDRRYTTQKYLNTHLKMSHPFPQA-----FKCVDCKATFDVDRALAQHRRKEHTEFACQLCDK 263
              .:...||.   :|:...:.|...|     ::||:|...||.......||........|.:|:.
  Fly   481 SSTNNNSTTN---STNSNNNTPAATATVTTSYQCVECVEKFDSKELFDIHRSGHANNMKCAICNM 542

  Fly   264 VFKSSRSLLRHVQGHSGARTFKC---EHENCGKSFVNQHNLTSHRRVH----SEERNYVCELCGY 321
            |.||.::..:|        ..:|   |.:.||:....:.|...|.|||    ||...|.||:|..
  Fly   543 VLKSLKNYEKH--------CLRCKPYECQICGRVVRFRPNFIKHMRVHTGQQSERHKYKCEVCHK 599

  Fly   322 RSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALY 386
            .....|...||::.|.......|:.|.:.|::.:.|..|..:||..|.:|||.|...|.:...|.
  Fly   600 EFMSFEYFKVHKKIHNENVNLTCEICGKVFSALASLRGHSKLHSGVKLHKCDVCGKGFGQRYNLK 664

  Fly   387 HHKHLHLGIKKFKCKICGNAYAQAAGLSAHMRAH 420
            .|...|.|...|:||||.......:.|..||:.|
  Fly   665 IHARTHTGDFPFECKICKKKLHTQSSLQTHMQVH 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 7/20 (35%)
COG5048 <258..416 CDD:227381 48/164 (29%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 6/24 (25%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 10/23 (43%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 6/27 (22%)
C2H2 Zn finger 562..582 CDD:275368 5/19 (26%)
C2H2 Zn finger 594..614 CDD:275368 6/19 (32%)
C2H2 Zn finger 622..642 CDD:275368 5/19 (26%)
zf-C2H2 648..670 CDD:278523 7/21 (33%)
C2H2 Zn finger 650..670 CDD:275368 6/19 (32%)
zf-H2C2_2 662..684 CDD:290200 9/21 (43%)
C2H2 Zn finger 678..698 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.