DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and Zbtb18

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001012330.1 Gene:Zbtb18 / 30928 MGIID:1353609 Length:531 Species:Mus musculus


Alignment Length:536 Identity:107/536 - (19%)
Similarity:182/536 - (33%) Gaps:173/536 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RH------CLANVDYVRLHAQQQLRPKCG---EIFYEPEANRFQLVCLLCDM------------- 45
            ||      |...|...:..|.:.:...|.   .:||:.:.::..:|.|..|:             
Mouse    27 RHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 91

  Fly    46 -------KHFGFEDFARHIRNVH-FDKQGRPLTKTVTGLGRLAREEQEFQGVSAEPLAVDSFKKE 102
                   |....||.......:| :|            :.::.:::.:.:..:    ..||.|||
Mouse    92 YEGKLQFKDLPIEDVLAAASYLHMYD------------IVKVCKKKLKEKATT----EADSTKKE 140

  Fly   103 YLPNEDVLSEEEDAEQ----------ELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQ--PDHD 155
                ||..|..:..|.          :|..::|||...::.:|..|:.:..|. ..||.  |...
Mouse   141 ----EDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDDKLNILPSKRDLAAEP-GNMWMRLPSDS 200

  Fly   156 -------------------------SSSASVNE------------GCALE-----ALLGVEN-PQ 177
                                     ||:.|:::            .|.|:     :|.|||| ..
Mouse   201 AGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNS 265

  Fly   178 DYQPDED----------GEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKM----SHPFP- 227
            .|...:|          .|:..|..:......||:..|.    |.::.::|:.::    :|..| 
Mouse   266 SYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHS----TVKESVSTNNRVQYEPAHLAPL 326

  Fly   228 ---QAFKCVDCKATFDVDRALAQHRRKEHTE---------------------FACQLCDKVFKSS 268
               ...:.:|.:.....|..:.....:...|                     |.|.||:|||.|.
Mouse   327 REDSVLRELDREDKASDDEMMTPESERVQVEGGMENSLLPYVSNILSPAGQIFMCPLCNKVFPSP 391

  Fly   269 RSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHR 333
            ..|..|:..|                |..|..:.|  :..::.....|.|||........|..|.
Mouse   392 HILQIHLSTH----------------FREQDGIRS--KPAADVNVPTCSLCGKTFSCMYTLKRHE 438

  Fly   334 RTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKF 398
            |||:||||:.|..|.:.|.....|:.|..:|:.|||:.|..|:..|::...||.|      |:||
Mouse   439 RTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRH------IRKF 497

  Fly   399 KCKICGNAYAQAAGLS 414
            .|::..:...::..||
Mouse   498 HCELVNSLSVKSEALS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 2/20 (10%)
COG5048 <258..416 CDD:227381 47/157 (30%)
C2H2 Zn finger 258..278 CDD:275368 9/19 (47%)
C2H2 Zn finger 289..308 CDD:275368 3/18 (17%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 12/24 (50%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 9/23 (39%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 3/15 (20%)
Zbtb18NP_001012330.1 BTB_POZ_ZBTB18_RP58 10..156 CDD:349633 25/148 (17%)
COG5048 <303..>490 CDD:227381 47/208 (23%)
C2H2 Zn finger 381..401 CDD:275368 9/19 (47%)
C2H2 Zn finger 421..441 CDD:275368 7/19 (37%)
zf-H2C2_2 434..456 CDD:404364 11/21 (52%)
C2H2 Zn finger 449..469 CDD:275368 5/19 (26%)
C2H2 Zn finger 477..495 CDD:275368 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.