DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and Hic2

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001099332.1 Gene:Hic2 / 287940 RGDID:1305338 Length:622 Species:Rattus norvegicus


Alignment Length:400 Identity:92/400 - (23%)
Similarity:137/400 - (34%) Gaps:118/400 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQ--------PDHDSSSASVNEGCALEALLGV 173
            ||||||:..:.:|    .|.....|...|.:...|        |...|:||           |.|
  Rat   241 EQELGLDLSKKSP----PLPPTTPVPHLTPEDPAQLSDSQRESPPPTSTSA-----------LPV 290

  Fly   174 ENPQDY-----QPDE----DG--EEHQSVFKKQ-RQP----------KDYN-------------- 202
            .|...|     .|||    :|  |.|.|:.:.| .||          ||:|              
  Rat   291 SNSTSYVELGATPDEPMDLEGAEENHLSLLEGQGGQPRKSLRHSARKKDWNKKEPVAGSPFDRRE 355

  Fly   203 ------CPHCDRRYTTQKYLNTHLKMS-------------HPFPQAFKCVDCKATFDVDRALAQH 248
                  ||..:......:..|..|..|             .|:|       ||...:..:.:::.
  Rat   356 TGSKSSCPGEEGEAPGDRVPNGVLASSAGGGGPSAPSYGEPPYP-------CKEEEENGKDVSED 413

  Fly   249 RRKEHTE---------------------------FACQLCDKVFKSSRSLLRHVQGHSGARTFKC 286
            ..:..:|                           :.|..|.|.|.||..|..||:.|:....|..
  Rat   414 SGQSGSEGGSGHTGGAHYVYRQEGYETVSYGDNLYVCIPCAKGFPSSEQLNAHVETHTEEELFIK 478

  Fly   287 E----HENCGKSFVNQHNLT--SHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQ 345
            |    ....|.:.....:|:  |.....:|.|.:.|.:|....:....|..|.:||...:||.|.
  Rat   479 EEGAYETGSGGAEEEAEDLSTPSSTAYAAEPRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCN 543

  Fly   346 TCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQA 410
            .|.:.|..:..:..|...|...||:.||:|...|:|...|..|..:|.|.|.::|::||..:.|.
  Rat   544 ICGKMFTQRGTMTRHMRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQ 608

  Fly   411 AGLSAHMRAH 420
            ..|.:|:|.|
  Rat   609 RNLISHLRMH 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 2/20 (10%)
COG5048 <258..416 CDD:227381 47/163 (29%)
C2H2 Zn finger 258..278 CDD:275368 9/19 (47%)
C2H2 Zn finger 289..308 CDD:275368 3/20 (15%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..353 CDD:290200 9/24 (38%)
C2H2 Zn finger 344..364 CDD:275368 4/19 (21%)
zf-H2C2_2 357..381 CDD:290200 8/23 (35%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
Hic2NP_001099332.1 BTB_POZ 25..144 CDD:365784
C2H2 Zn finger 450..470 CDD:275368 9/19 (47%)
SUF4-like 510..>559 CDD:411020 12/48 (25%)
C2H2 Zn finger 514..534 CDD:411020 4/19 (21%)
C2H2 Zn finger 514..534 CDD:275368 4/19 (21%)
zf-C2H2 540..562 CDD:395048 5/21 (24%)
C2H2 Zn finger 542..562 CDD:275368 4/19 (21%)
C2H2 Zn finger 542..559 CDD:411020 3/16 (19%)
zf-C2H2 568..590 CDD:395048 7/21 (33%)
C2H2 Zn finger 570..590 CDD:275368 7/19 (37%)
zf-H2C2_2 582..607 CDD:404364 8/24 (33%)
C2H2 Zn finger 598..618 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.