DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and ZBTB11

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_055230.2 Gene:ZBTB11 / 27107 HGNCID:16740 Length:1053 Species:Homo sapiens


Alignment Length:403 Identity:102/403 - (25%)
Similarity:164/403 - (40%) Gaps:82/403 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 RLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVD 142
            :|::|..    :|:.|  .||.....:..||:.:|:....:     |....||:     .::::.
Human   440 KLSKENV----ISSSP--EDSGMGNDISAEDICAEDIPKHR-----QKVDQPLK-----DQENLV 488

  Fly   143 EETIDTMWQPDHDS-----SSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVF-------KKQ 195
            ..|..|.:.||.|:     ...|||||..:....|:|.....:........|.|.       ||.
Human   489 ASTAKTDFGPDDDTYRSRLRQRSVNEGAYIRLHKGMEKKLQKRKAVPKSAVQQVAQKLVQRGKKM 553

  Fly   196 RQPK----------DYNCPHC----DRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRA-- 244
            :|||          .:.|..|    .|||.    |..| |:.|...:.:||..||..|....:  
Human   554 KQPKRDAKENTEEASHKCGECGMVFQRRYA----LIMH-KLKHERARDYKCPLCKKQFQYSASLR 613

  Fly   245 --LAQHRRKE------------------------HTEFACQLCDKVFKSSRSLLRHVQGHSGART 283
              |.:|.||:                        ..||.|.:|.:......||..|:..|:|.:.
Human   614 AHLIRHTRKDAPSSSSSNSTSNEASGTSSEKGRTKREFICSICGRTLPKLYSLRIHMLKHTGVKP 678

  Fly   284 FKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCA 348
            ..|  :.|||:|:.:|.|..|:.:|..::.:.||||......:.:|..|...||||..:.|..|.
Human   679 HAC--QVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRSLQEHMSIHTGESKYLCSVCG 741

  Fly   349 RRFASKSLLNEHQAMHSTEKP----YKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQ 409
            :.|...|.|::|...|. .||    |.|.:|:.:|...:.|..|.:.|||:|.|:|:.|...|:.
Human   742 KSFHRGSGLSKHFKKHQ-PKPEVRGYHCTQCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSW 805

  Fly   410 AAGLSAHMRAHKL 422
            .....:|:::|.:
Human   806 KKDWYSHVKSHSV 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 8/48 (17%)
COG5048 <258..416 CDD:227381 49/161 (30%)
C2H2 Zn finger 258..278 CDD:275368 5/19 (26%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 9/24 (38%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 9/27 (33%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
C2H2 Zn finger 400..420 CDD:275368 4/19 (21%)
ZBTB11NP_055230.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..173
BTB 204..305 CDD:279045
BTB 215..306 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 546..566 5/19 (26%)
C2H2 Zn finger 571..591 CDD:275368 8/24 (33%)
C2H2 Zn finger 599..619 CDD:275368 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 619..643 3/23 (13%)
C2H2 Zn finger 653..673 CDD:275368 5/19 (26%)
zf-H2C2_2 665..690 CDD:290200 10/26 (38%)
C2H2 Zn finger 681..701 CDD:275368 8/21 (38%)
C2H2 Zn finger 709..729 CDD:275368 6/19 (32%)
zf-H2C2_2 721..746 CDD:290200 9/24 (38%)
C2H2 Zn finger 737..757 CDD:275368 6/19 (32%)
C2H2 Zn finger 768..788 CDD:275368 5/19 (26%)
zf-H2C2_2 780..804 CDD:290200 9/23 (39%)
C2H2 Zn finger 796..816 CDD:275368 4/19 (21%)
C2H2 Zn finger 860..880 CDD:275368
C2H2 Zn finger 888..908 CDD:275368
zf-H2C2_2 900..923 CDD:290200
C2H2 Zn finger 916..937 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.