DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and Zbtb38

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_036010907.1 Gene:Zbtb38 / 245007 MGIID:2442866 Length:1243 Species:Mus musculus


Alignment Length:371 Identity:94/371 - (25%)
Similarity:146/371 - (39%) Gaps:83/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KKEYLPNEDVLSEEEDAE----QELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDH------ 154
            |.:|...|:.|..|.|.|    ..|||.|.|   ...|.....:..|:::.|..|:|.:      
Mouse   908 KPKYQMQEETLPRENDPETPGDSPLGLCQAE---CVEMSEAFDEVSDQDSTDKPWRPYYNYKPKK 969

  Fly   155 ---------------DSSSASVNEGCALEALLG---VENPQD--YQPDEDGEEHQSVFKKQRQPK 199
                           :..|.|....|...|.|.   |:.|.|  ::.:|:.||::.:.|.|    
Mouse   970 KSKQLRKMRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEEENKEMPKLQ---- 1030

  Fly   200 DYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFACQLCDKV 264
               |..||                       .|.|..|....:....||...:  .:.|:||.|.
Mouse  1031 ---CELCD-----------------------GCPDGAAGAGAEGKPHQHLTSK--PYICELCAKQ 1067

  Fly   265 FKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREAL 329
            |:||.:|..|::.|:|.:.::|  :.||:.|..|.||..|.|:|...:.::|:.|.......|.|
Mouse  1068 FQSSSTLKMHMRCHTGEKPYQC--KTCGRCFSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETL 1130

  Fly   330 IVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTE---KPYKCDKCDSAFSRPKALYHH--K 389
            .:|.|.|||||.:.||.|.:.|...|....|:..|..|   |.:.|.:|........||..|  |
Mouse  1131 KIHERIHTGEKRYHCQFCFQGFLYLSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKK 1195

  Fly   390 HLHLGIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEGAEAE 435
            ||:..:.|          .:..|.:.|..|..|::.: .|:..::|
Mouse  1196 HLYKTLPK----------QEETGDTCHENADLLESQL-CTDSEDSE 1230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 5/20 (25%)
COG5048 <258..416 CDD:227381 51/162 (31%)
C2H2 Zn finger 258..278 CDD:275368 9/19 (47%)
C2H2 Zn finger 289..308 CDD:275368 8/18 (44%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 12/24 (50%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 6/26 (23%)
C2H2 Zn finger 372..392 CDD:275368 7/21 (33%)
C2H2 Zn finger 400..420 CDD:275368 2/19 (11%)
Zbtb38XP_036010907.1 BTB_POZ_ZBTB38_CIBZ 61..174 CDD:349532
zf-C2H2_8 <386..446 CDD:406359
C2H2 Zn finger 388..408 CDD:275368
C2H2 Zn finger 417..436 CDD:275368
C2H2 Zn finger 506..526 CDD:275368
C2H2 Zn finger 534..554 CDD:275368
C2H2 Zn finger 562..580 CDD:275368
C2H2 Zn finger 1061..1081 CDD:275368 9/19 (47%)
zf-H2C2_2 1074..1097 CDD:404364 7/24 (29%)
zf-C2H2 1087..1109 CDD:395048 9/23 (39%)
C2H2 Zn finger 1089..1109 CDD:275368 9/21 (43%)
C2H2 Zn finger 1117..1137 CDD:275368 6/19 (32%)
C2H2 Zn finger 1145..1165 CDD:275368 6/19 (32%)
C2H2 Zn finger 1176..1196 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.