Sequence 1: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055909.2 | Gene: | HIC2 / 23119 | HGNCID: | 18595 | Length: | 615 | Species: | Homo sapiens |
Alignment Length: | 390 | Identity: | 93/390 - (23%) |
---|---|---|---|
Similarity: | 131/390 - (33%) | Gaps: | 130/390 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 GLGRLAREEQEFQGVSAEPLAVDSFKKE----------YLPNEDV--LSEEEDAE---------- 117
Fly 118 -----QELG--------LEQDEGNPLRIMVLGG---KQSVDEETIDTMW---QP----DHDSSSA 159
Fly 160 SVNEGCALEALLGV------------------------------ENPQDYQPD------EDGEEH 188
Fly 189 QSVFKKQRQ---------PKDYNCPHCDRRYTTQKYLNTHLK----------------------- 221
Fly 222 -----MSHPF------PQAFKCVDCKATFDVDRALAQHRRKEH---TEFACQLCDKVFKSSRSLL 272
Fly 273 RHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHT 337
Fly 338 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 7/20 (35%) |
COG5048 | <258..416 | CDD:227381 | 33/80 (41%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 8/18 (44%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 6/10 (60%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | |||
zf-H2C2_2 | 357..381 | CDD:290200 | |||
C2H2 Zn finger | 372..392 | CDD:275368 | |||
C2H2 Zn finger | 400..420 | CDD:275368 | |||
HIC2 | NP_055909.2 | BTB | 40..140 | CDD:279045 | |
BTB | 47..141 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..167 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..208 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 229..421 | 33/191 (17%) | |||
Binding to CtBP | 246..250 | 1/3 (33%) | |||
TMEM119 | <300..395 | CDD:292352 | 15/94 (16%) | ||
C2H2 Zn finger | 444..464 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2 | 505..527 | CDD:278523 | 9/22 (41%) | ||
C2H2 Zn finger | 507..527 | CDD:275368 | 7/20 (35%) | ||
zf-C2H2 | 533..555 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 535..555 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 548..572 | CDD:290200 | 9/25 (36%) | ||
COG5048 | 559..>613 | CDD:227381 | 25/56 (45%) | ||
C2H2 Zn finger | 563..583 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 576..600 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 591..611 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |