Sequence 1: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036016934.1 | Gene: | Zbtb7c / 207259 | MGIID: | 2443302 | Length: | 625 | Species: | Mus musculus |
Alignment Length: | 402 | Identity: | 84/402 - (20%) |
---|---|---|---|
Similarity: | 129/402 - (32%) | Gaps: | 180/402 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 NEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETI---------------DTMWQPDHD 155
Fly 156 SS--------------SASVNEGCALEALL---------------------------------GV 173
Fly 174 -----ENPQDYQP-----------DEDGEE--------HQSVFKKQRQP-------------KDY 201
Fly 202 NCPHCDRRYTTQKYLN----THL-KMSHPFPQAFKCVDCKATFDVDRALAQHRR-KEHTEFACQL 260
Fly 261 CDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRY 325
Fly 326 REALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKH 390
Fly 391 LHLGIKKFKCKI 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 3/21 (14%) |
COG5048 | <258..416 | CDD:227381 | 40/145 (28%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 0/18 (0%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 357..381 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 1/3 (33%) | ||
Zbtb7c | XP_036016934.1 | BTB_POZ_ZBTB7C_ZBTB36 | 15..134 | CDD:349637 | |
C2H2 Zn finger | 372..392 | CDD:275368 | 7/19 (37%) | ||
SFP1 | <386..474 | CDD:227516 | 32/123 (26%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 428..448 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 456..474 | CDD:275368 | 7/23 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |