DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and M03D4.4

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:244 Identity:63/244 - (25%)
Similarity:94/244 - (38%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 FKCVDCKATFDVDRALAQHRRKEH--TEFACQLCDKVFKSSRSLL-------------------- 272
            :.|.||...|.....|.:|.|:||  .|...|..|::...|..|.                    
 Worm     5 YLCRDCSGAFHSLDELQRHEREEHETVEQGDQEEDRMEDDSDELAMIKIKIEDSDFLSDTDSSQL 69

  Fly   273 ---------RHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREA 328
                     :...|..|  .::|  |:|.:.|..:..|.:|.|:||.|:.:.|..||.....|:.
 Worm    70 SMNPTTPSEKSSSGEKG--RYEC--EDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQL 130

  Fly   329 LIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHL 393
            |..|...||||:...|..|.:.|..|..|.:|..:||..:|::|.:|...|.....|..|..:|.
 Worm   131 LKKHWMWHTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIHQ 195

  Fly   394 GIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEGAEAEPIEMLFT 442
            . :.|.|:.||.::.:...|..|....|         |..:.||..|.|
 Worm   196 E-RGFSCQQCGRSFLKQVMLDEHHLKCK---------GKPSSPIRSLLT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 7/20 (35%)
COG5048 <258..416 CDD:227381 46/186 (25%)
C2H2 Zn finger 258..278 CDD:275368 4/48 (8%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 9/24 (38%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 8/23 (35%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 7/21 (33%)
zf-H2C2_2 102..127 CDD:290200 9/24 (38%)
C2H2 Zn finger 118..138 CDD:275368 6/19 (32%)
C2H2 Zn finger 146..166 CDD:275368 6/19 (32%)
zf-H2C2_2 158..181 CDD:290200 7/22 (32%)
zf-C2H2 172..194 CDD:278523 5/21 (24%)
C2H2 Zn finger 174..194 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.