DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and blmp-1

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001251370.1 Gene:blmp-1 / 172917 WormBaseID:WBGene00003847 Length:817 Species:Caenorhabditis elegans


Alignment Length:375 Identity:93/375 - (24%)
Similarity:139/375 - (37%) Gaps:110/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FEDFAR---HIRNVHFDKQGRPLTKT---VTGLGRLAREEQEFQGVSAEPLAVDSFKKEYLPNED 108
            |::|.|   .::.|.......|:.:|   :|..|          |.|.:|:.|          :.
 Worm   370 FKEFMRKSLQLKLVDTSMFVSPVAQTTAAITATG----------GRSGQPIDV----------QP 414

  Fly   109 VLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCALEALLGV 173
            ||:....|.        .||...|.   |.|....|    :.:|.:.|:|.:...|..:....|:
 Worm   415 VLAATAGAH--------FGNYAAIY---GSQDFQHE----LSKPLYTSASPAFGGGGGMGGGFGM 464

  Fly   174 ENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKAT 238
                      .|..|.|.|        :..|          ::| |...||.          .::
 Worm   465 ----------GGSAHTSSF--------HQLP----------FVN-HSSSSHN----------DSS 490

  Fly   239 FDVDRALAQHRRKEHTEFACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTS 303
            |:......|.:....|.:||:.|:|.|....:|..||:.|:|.|.|||  |.|.|.|....:|..
 Worm   491 FNGVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKC--EICTKEFTQLAHLQK 553

  Fly   304 HRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEK 368
            |..|                            ||||:|.:|..|.:||:|.|.|..|..:|:.:|
 Worm   554 HHLV----------------------------HTGERPHRCDICDKRFSSTSNLKTHLRLHNGQK 590

  Fly   369 PYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQAAGLSAHMR 418
            ||.||.||:.|::...|..||.||...:.:.|..||..|...:||..|.:
 Worm   591 PYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWK 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 2/20 (10%)
COG5048 <258..416 CDD:227381 53/157 (34%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 0/19 (0%)
zf-H2C2_2 328..353 CDD:290200 9/24 (38%)
C2H2 Zn finger 344..364 CDD:275368 8/19 (42%)
zf-H2C2_2 357..381 CDD:290200 11/23 (48%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
blmp-1NP_001251370.1 SET 119..247 CDD:214614
zf-C2H2 508..530 CDD:278523 8/21 (38%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
zf-H2C2_2 522..547 CDD:290200 13/26 (50%)
C2H2 Zn finger 538..558 CDD:275368 8/49 (16%)
zf-H2C2_2 550..575 CDD:290200 12/52 (23%)
C2H2 Zn finger 566..586 CDD:275368 8/19 (42%)
zf-H2C2_2 578..603 CDD:290200 11/24 (46%)
C2H2 Zn finger 594..614 CDD:275368 8/19 (42%)
zf-H2C2_2 606..631 CDD:290200 9/24 (38%)
ARS2 <620..772 CDD:282772 7/21 (33%)
C2H2 Zn finger 622..641 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.