| Sequence 1: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006513342.3 | Gene: | Zbtb7a / 16969 | MGIID: | 1335091 | Length: | 725 | Species: | Mus musculus |
| Alignment Length: | 200 | Identity: | 58/200 - (28%) |
|---|---|---|---|
| Similarity: | 79/200 - (39%) | Gaps: | 47/200 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 240 DVDRALAQHRRKEHTEFA---CQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNL 301
Fly 302 TSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHST 366
Fly 367 EKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEG 431
Fly 432 AEAEP 436 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 5/12 (42%) |
| COG5048 | <258..416 | CDD:227381 | 47/157 (30%) | ||
| C2H2 Zn finger | 258..278 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 289..308 | CDD:275368 | 0/18 (0%) | ||
| C2H2 Zn finger | 316..336 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 328..353 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 344..364 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 357..381 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 372..392 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 400..420 | CDD:275368 | 4/19 (21%) | ||
| Zbtb7a | XP_006513342.3 | BTB_POZ_ZBTB7A | 165..284 | CDD:349635 | |
| C2H2 Zn finger | 534..554 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 549..571 | CDD:404364 | 9/51 (18%) | ||
| C2H2 Zn finger | 562..582 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 575..599 | CDD:404364 | 14/23 (61%) | ||
| C2H2 Zn finger | 590..610 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 602..627 | CDD:404364 | 9/24 (38%) | ||
| C2H2 Zn finger | 618..636 | CDD:275368 | 8/23 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||