DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and ZNF653

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_620138.2 Gene:ZNF653 / 115950 HGNCID:25196 Length:615 Species:Homo sapiens


Alignment Length:396 Identity:97/396 - (24%)
Similarity:149/396 - (37%) Gaps:88/396 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HFGFEDFARHIRNVHFDKQGRPLTKTVTGLGRLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLS 111
            |..|:  ..|:.::  .:||.||.....|.|..|.|......|..:..|..|...|.:|.|    
Human   243 HIPFD--VHHVESL--AEQGTPLCSNPAGNGPEALETVVCVPVPVQVGAGPSALFENVPQE---- 299

  Fly   112 EEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCALEAL------ 170
                   .|| |.....|:..||.|.:       :..:..|.:|:.:|   ||..|...      
Human   300 -------ALG-EVVASCPMPGMVPGSQ-------VIIIAGPGYDALTA---EGIHLNMAAGSGVP 346

  Fly   171 ---LGVE---------------NPQDYQPD----------EDGEEHQSVFKKQRQPKDYNCPHCD 207
               ||.|               .|:..||.          |..:|.:.:...:::.|:.  |...
Human   347 GSGLGEEVPCAMMEGVAAYTQTEPEGSQPSTMDATAVAGIETKKEKEDLCLLKKEEKEE--PVAP 409

  Fly   208 RRYTTQKYLNTHLKMSHPFPQA----FKCVDCKA-TFDVDRALAQHRRKEHTE----------FA 257
            ...||..      :.:.|..:|    ....|..| .:::.:...:.||.:.:.          |.
Human   410 ELATTVP------ESAEPEAEADGEELDGSDMSAIIYEIPKEPEKRRRSKRSRVMDADGLLEMFH 468

  Fly   258 C--QLCDKVFKSSRSLLRHVQ-GHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELC 319
            |  :.|.:|:.:..|...||. .|...:|..|.|..|||.|...::|..|..:||..|.:.||.|
Human   469 CPYEGCSQVYVALSSFQNHVNLVHRKGKTKVCPHPGCGKKFYLSNHLRRHMIIHSGVREFTCETC 533

  Fly   320 GYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYK--CDKCDSAFSRP 382
            |...:.:..|.|||||||||.|.||:.|..:...::.||.|...|:.|..|.  ||:|...|.:.
Human   534 GKSFKRKNHLEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTAEVQYNFTCDRCGKRFEKL 598

  Fly   383 KALYHH 388
            .::..|
Human   599 DSVKFH 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 4/21 (19%)
COG5048 <258..416 CDD:227381 48/136 (35%)
C2H2 Zn finger 258..278 CDD:275368 6/22 (27%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 9/19 (47%)
zf-H2C2_2 328..353 CDD:290200 14/24 (58%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 10/25 (40%)
C2H2 Zn finger 372..392 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..420 CDD:275368
ZNF653NP_620138.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..117
Nuclear localization signal. /evidence=ECO:0000255 107..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..236
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..432 6/38 (16%)
Nuclear localization signal. /evidence=ECO:0000255 445..451 0/5 (0%)
COG5048 <486..614 CDD:227381 44/119 (37%)
C2H2 Zn finger 503..522 CDD:275368 6/18 (33%)
zf-H2C2_2 514..539 CDD:316026 9/24 (38%)
C2H2 Zn finger 530..550 CDD:275368 9/19 (47%)
C2H2 Zn finger 558..578 CDD:275368 5/19 (26%)
C2H2 Zn finger 588..609 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5104
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.