DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10959 and zbtb18

DIOPT Version :9

Sequence 1:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001076421.1 Gene:zbtb18 / 100003157 ZFINID:ZDB-GENE-050419-73 Length:537 Species:Danio rerio


Alignment Length:384 Identity:90/384 - (23%)
Similarity:137/384 - (35%) Gaps:110/384 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GRPLTKTVTGLGRLAREEQEFQGVSAE-PLAVDSFKKEYL---PNEDVLSEEEDAEQELGLEQDE 126
            |.|.:.|    |.|:|.....:.|||: ...:|...|..|   |.|::                .
Zfish   211 GSPSSST----GSLSRRSAASRRVSADTDCVLDLSVKSSLGGGPGENI----------------A 255

  Fly   127 GNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDED----GE- 186
            |||.                          ..:||.......||:.|:..:|...|:|    |: 
Zfish   256 GNPY--------------------------FCSSVTPDSLQSALVQVKVEKDTGSDDDELVSGDY 294

  Fly   187 --EHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHR 249
              ||..|    ::|...|..|.......:..|..||....                 :.:||...
Zfish   295 EMEHSGV----KEPPSTNGTHLSLVAQRRLGLEAHLSALR-----------------EASLASEL 338

  Fly   250 RK------EHTEFACQLCDKVFKSS---RSLLRHVQGHSGA---RTFKCEHENCGKSFVNQHNLT 302
            .:      :.|:......|:|.:::   .|||.:|....||   :.|.|  ..|.|.|.:.|.|.
Zfish   339 ERDDKGGDDDTDVLGGDSDRVQEAAGVESSLLPYVSSMLGAPHTQIFMC--PLCNKVFPSPHILQ 401

  Fly   303 SHRRVHSEERNYV------------CELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKS 355
            .|...|..|:..|            |.:||........|..|.|||:||||:.|.||.:.|....
Zfish   402 IHLSTHFREQEGVRAKPAGDVNVPTCSICGKTFSCMYTLKRHERTHSGEKPYTCTTCGKSFQYSH 466

  Fly   356 LLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKFKCKICGNAYAQAAGLS 414
            .|:.|..:|:.|||:.|..|:..|::...||.|      |:||.|::..:...::..|:
Zfish   467 NLSRHAVVHTREKPHACKWCERRFTQSGDLYRH------IRKFHCELVNSLSVKSEALN 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 2/26 (8%)
COG5048 <258..416 CDD:227381 52/175 (30%)
C2H2 Zn finger 258..278 CDD:275368 6/22 (27%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 13/24 (54%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 9/23 (39%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 2/15 (13%)
zbtb18NP_001076421.1 BTB 14..110 CDD:279045
BTB 25..110 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..232 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..355 2/19 (11%)
C2H2 Zn finger 387..407 CDD:275368 7/21 (33%)
COG5048 <388..>496 CDD:227381 34/107 (32%)
C2H2 Zn finger 427..447 CDD:275368 6/19 (32%)
zf-H2C2_2 440..462 CDD:290200 12/21 (57%)
C2H2 Zn finger 455..475 CDD:275368 6/19 (32%)
C2H2 Zn finger 483..501 CDD:275368 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.