DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15336 and ZNF235

DIOPT Version :9

Sequence 1:	NP_572450.4	Gene:	CG15336 / 31742	FlyBaseID:	FBgn0030009	Length:	159	Species:	Drosophila melanogaster
Sequence 2:	NP_004225.3	Gene:	ZNF235 / 9310	HGNCID:	12866	Length:	738	Species:	Homo sapiens

Alignment Length:	109	Identity:	43/109 - (39%)
Similarity:	57/109 - (52%)	Gaps:	4/109 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 CEFCGYRTRIYWNLQIHRRRHTGEMPFSCQQCQARFPASYQLKSHLERHLDAGERRQRHICTDCN 81
            ||.||.......|||.|:..||||.||.|..||.||..:..|::|...|  .||:..:  |..|.
Human   573 CEECGKGFSQASNLQAHQSVHTGEKPFKCDACQKRFSQASHLQAHQRVH--TGEKPYK--CDTCG 633

  Fly    82 VGFSSSRALYHHRTLHEDGKRFKCSQCDKSFAQAAGYAQHKRIH 125
            ..||....|..|:.:|...|.|||.:|.|.|:.:||.:.|:|:|
Human   634 KAFSQRSNLQVHQIIHTGEKPFKCEECGKEFSWSAGLSAHQRVH 677

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15336	NP_572450.4	C2H2 Zn finger	17..37	CDD:275370	8/19 (42%)
		zf-H2C2_2	29..52	CDD:290200	13/22 (59%)
		C2H2 Zn finger	45..65	CDD:275368	7/19 (37%)
		C2H2 Zn finger	77..97	CDD:275368	6/19 (32%)
		C2H2 Zn finger	105..125	CDD:275368	8/19 (42%)
ZNF235	NP_004225.3	KRAB A domain	6..47
		KRAB	8..68	CDD:214630
		KRAB	8..47	CDD:279668
		KRAB B domain	48..80
		C2H2 Zn finger	266..285	CDD:275368
		COG5048	321..662	CDD:227381	36/92 (39%)
		C2H2 Zn finger	321..341	CDD:275368
		zinc finger domain	321..341
		zf-H2C2_2	333..358	CDD:290200
		C2H2 Zn finger	349..369	CDD:275368
		zinc finger domain	349..369
		C2H2 Zn finger	377..397	CDD:275368
		zinc finger domain	377..397
		zf-H2C2_2	389..414	CDD:290200
		C2H2 Zn finger	405..425	CDD:275368
		zinc finger domain	405..425
		zf-H2C2_2	417..442	CDD:290200
		C2H2 Zn finger	433..453	CDD:275368
		zinc finger domain	433..453
		zf-H2C2_2	448..469	CDD:290200
		C2H2 Zn finger	461..481	CDD:275368
		zinc finger domain	461..481
		zf-H2C2_2	476..498	CDD:290200
		C2H2 Zn finger	489..509	CDD:275368
		zinc finger domain	489..509
		zf-H2C2_2	501..526	CDD:290200
		C2H2 Zn finger	517..537	CDD:275368
		zinc finger domain	517..537
		zf-H2C2_2	529..553	CDD:290200
		C2H2 Zn finger	545..565	CDD:275368
		zinc finger domain	545..565
		zf-H2C2_2	560..582	CDD:290200	4/8 (50%)
		C2H2 Zn finger	573..593	CDD:275368	8/19 (42%)
		zinc finger domain	573..593		8/19 (42%)
		zf-H2C2_2	585..610	CDD:290200	15/24 (63%)
		C2H2 Zn finger	601..621	CDD:275368	7/19 (37%)
		zinc finger domain	601..621		7/19 (37%)
		zf-H2C2_2	613..638	CDD:290200	8/28 (29%)
		C2H2 Zn finger	629..649	CDD:275368	6/19 (32%)
		zinc finger domain	629..649		6/19 (32%)
		zf-H2C2_2	641..665	CDD:290200	9/23 (39%)
		C2H2 Zn finger	657..677	CDD:275368	8/19 (42%)
		zinc finger domain	657..677		8/19 (42%)
		zf-H2C2_2	670..694	CDD:290200	3/8 (38%)
		C2H2 Zn finger	685..705	CDD:275368
		zinc finger domain	685..705
		C2H2 Zn finger	713..733	CDD:275368
		zinc finger domain	713..733
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4779
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950