DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15336 and ZAP1

DIOPT Version :9

Sequence 1:NP_572450.4 Gene:CG15336 / 31742 FlyBaseID:FBgn0030009 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_012479.1 Gene:ZAP1 / 853390 SGDID:S000003592 Length:880 Species:Saccharomyces cerevisiae


Alignment Length:80 Identity:31/80 - (38%)
Similarity:41/80 - (51%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HRRRHTGEMPFSCQQCQARFPASYQLKSHLERHLDAGERRQRHICTDCNVGFSSSRALYHHRTLH 97
            |.|.|:||.|:.|..|..:|..|..||.|:..|  .||:..:  |..|...|:.|..|..|...|
Yeast   786 HTRTHSGEKPYKCHICNKKFAISSSLKIHIRTH--TGEKPLQ--CKICGKRFNESSNLSKHIKTH 846

  Fly    98 EDGKRFKCSQCDKSF 112
            :  |::|||.|.|||
Yeast   847 Q--KKYKCSDCSKSF 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15336NP_572450.4 C2H2 Zn finger 17..37 CDD:275370 2/3 (67%)
zf-H2C2_2 29..52 CDD:290200 8/18 (44%)
C2H2 Zn finger 45..65 CDD:275368 7/19 (37%)
C2H2 Zn finger 77..97 CDD:275368 6/19 (32%)
C2H2 Zn finger 105..125 CDD:275368 6/8 (75%)
ZAP1NP_012479.1 COG5048 292..761 CDD:227381
C2H2 Zn finger 743..762 CDD:275368
SUF4-like 766..>814 CDD:411020 12/27 (44%)
C2H2 Zn finger 770..795 CDD:411020 5/8 (63%)
C2H2 Zn finger 770..790 CDD:275368 2/3 (67%)
C2H2 Zn finger 798..818 CDD:275368 7/19 (37%)
zf-H2C2_2 810..834 CDD:404364 8/27 (30%)
C2H2 Zn finger 826..846 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.