DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15336 and zbtb40

DIOPT Version :9

Sequence 1:	NP_572450.4	Gene:	CG15336 / 31742	FlyBaseID:	FBgn0030009	Length:	159	Species:	Drosophila melanogaster
Sequence 2:	XP_005172972.1	Gene:	zbtb40 / 571158	ZFINID:	ZDB-GENE-030131-1704	Length:	1061	Species:	Danio rerio

Alignment Length:	122	Identity:	41/122 - (33%)
Similarity:	62/122 - (50%)	Gaps:	6/122 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 PAASSDNRRLMCEFCGYRTRIYWNLQIHRR-RHTGEMPFSCQQCQARFPASYQLKSHLERHLDAG 69
            ||.......:.|:.|....:....|..|:| .|..|.|::|::|.|:|.|:..||:|:..|  .|
Zfish   651 PAKKKKTEHVACDICDKTFKHSSGLLYHKRTEHFEERPYACEECGAKFAATSSLKNHMRLH--TG 713

  Fly    70 ERRQRHICTDCNVGFSSSRAL-YHHRTLHEDGKRFKCSQCDKSFAQAAGYAQHKRIH 125
            |:...  |..|::.||.:.|| ||.:..|.:||.:.|..|..||||:....:|.|.|
Zfish   714 EKPFH--CKHCDMSFSVAAALSYHTKKKHAEGKMYCCQYCSASFAQSIELTRHVRTH 768

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15336	NP_572450.4	C2H2 Zn finger	17..37	CDD:275370	5/20 (25%)
		zf-H2C2_2	29..52	CDD:290200	9/23 (39%)
		C2H2 Zn finger	45..65	CDD:275368	8/19 (42%)
		C2H2 Zn finger	77..97	CDD:275368	8/20 (40%)
		C2H2 Zn finger	105..125	CDD:275368	8/19 (42%)
zbtb40	XP_005172972.1	BTB	14..113	CDD:279045
		BTB	25..113	CDD:197585
		C2H2 Zn finger	626..647	CDD:275368
		C2H2 Zn finger	662..683	CDD:275368	5/20 (25%)
		C2H2 Zn finger	691..711	CDD:275368	8/19 (42%)
		zf-H2C2_2	703..727	CDD:290200	8/27 (30%)
		C2H2 Zn finger	719..768	CDD:275368	19/48 (40%)
		zf-H2C2_2	760..785	CDD:290200	3/9 (33%)
		C2H2 Zn finger	776..797	CDD:275368
		C2H2 Zn finger	833..853	CDD:275368
		C2H2 Zn finger	861..882	CDD:275368
		C2H2 Zn finger	900..917	CDD:275368
		C2H2 Zn finger	929..947	CDD:275368
		C2H2 Zn finger	957..973	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170596618
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930