DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15336 and F56D1.1

DIOPT Version :9

Sequence 1:	NP_572450.4	Gene:	CG15336 / 31742	FlyBaseID:	FBgn0030009	Length:	159	Species:	Drosophila melanogaster
Sequence 2:	NP_495042.3	Gene:	F56D1.1 / 186375	WormBaseID:	WBGene00018959	Length:	454	Species:	Caenorhabditis elegans

Alignment Length:	127	Identity:	30/127 - (23%)
Similarity:	52/127 - (40%)	Gaps:	29/127 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 RRRHTGEMPFSCQQCQARFPASYQLKSHLE-RHLDAGER---------RQRHIC---------TD 79
            |.|..|:  |||:.|...|.....|:.|:. .|.:..::         ::::.|         |.
Worm   329 RSRVHGD--FSCEICLKTFTLRDNLRKHVRVYHSENSQKVVKSTGPKHQEQYKCDRKSKDGDETT 391

  Fly    80 CNVGFSSSRALYHHRTLHEDGKRFKCSQCDKSFAQAAGYAQHKRIHRQRNQRATETTDLKDL 141
            |...|.:.:||:.|..:|:..|.:.|..|::.|.....:|.|...:.|        |.:|||
Worm   392 CGKTFRTEQALHDHFNVHDGIKPYSCHTCNQKFHARDRFAVHLSKYHQ--------TSIKDL 445

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15336	NP_572450.4	C2H2 Zn finger	17..37	CDD:275370	1/2 (50%)
		zf-H2C2_2	29..52	CDD:290200	7/17 (41%)
		C2H2 Zn finger	45..65	CDD:275368	5/20 (25%)
		C2H2 Zn finger	77..97	CDD:275368	7/28 (25%)
		C2H2 Zn finger	105..125	CDD:275368	5/19 (26%)
F56D1.1	NP_495042.3	C2H2 Zn finger	67..87	CDD:275368
		C2H2 Zn finger	94..116	CDD:275368
		C2H2 Zn finger	338..359	CDD:275368	5/20 (25%)
		C2H2 Zn finger	380..409	CDD:275368	7/28 (25%)
		C2H2 Zn finger	417..434	CDD:275368	4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4779
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950