DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and STP4

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:57/298 - (19%)
Similarity:97/298 - (32%) Gaps:66/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VVLEKQDEDEDERPGRSIIKWQDHQSLTSE-SLRQVRALKVDYK-EEDSEQEECGM--------- 165
            :|.::|.:..:.....|.:. ..|..||:| :.|...:||...| .:..:::||.:         
Yeast   227 IVKQQQQQQLNSSSSASALP-SIHSPLTNEHTSRYSSSLKDSAKITKQRKKKECPICHNFYANLS 290

  Fly   166 ---ELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPV 227
               ...|..|.|     ||.||.|.:.:.....|.||..|..||... .:.:.::|.....|...
Yeast   291 THKSTHLTPEDR-----PHKCPICQRGFARNNDLIRHKKRHWKDEFM-QIYARESDNNSGADDQD 349

  Fly   228 KSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQA-- 290
            .:|                   |.....|.|:..:.       |...:.....:||.::.:::  
Yeast   350 DTA-------------------RTSANNDSDDSNDK-------LAASSSSEETKLLKKNQLKSLY 388

  Fly   291 --HGGAACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIR------HMRNHGKVHT 347
              .|...|...........|:..|:.:......:.|...|...|..|.:      |.....|...
Yeast   389 KIKGAFKCPYNSTLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKK 453

  Fly   348 EQKNFV---CESCGYSCRNKETLRVHIRSHTGERPFGC 382
            |.:..|   |:.||....|.:   |.:..|.|:   ||
Yeast   454 EDRGVVPGKCKHCGLQFPNVD---VWLNKHVGK---GC 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 3/19 (16%)
zf-C2H2_8 323..411 CDD:292531 17/69 (25%)
C2H2 Zn finger 327..346 CDD:275368 5/24 (21%)
C2H2 Zn finger 354..374 CDD:275368 5/19 (26%)
zf-H2C2_2 367..389 CDD:290200 5/16 (31%)
C2H2 Zn finger 382..402 CDD:275368 1/1 (100%)
zf-H2C2_2 395..419 CDD:290200
C2H2 Zn finger 410..430 CDD:275368
C2H2 Zn finger 438..458 CDD:275368
STP4NP_010235.1 COG5048 14..442 CDD:227381 44/247 (18%)
C2H2 Zn finger 279..296 CDD:275368 1/16 (6%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.