DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and STP3

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:52/232 - (22%)
Similarity:86/232 - (37%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 SCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEHCGKIYHGK 246
            |.||.||:.:.||..:..|.|.....|:    :..|.:..|:|.|       :||..|.:.:...
Yeast   128 STPHSTKINKPRKKKQCPICRNFYANLT----THKATHLTPEDRP-------HKCPICHRGFARN 181

  Fly   247 YSLRQHLKR--------------DHDNGEEGGSAI---------FTCLECEAQLPRLRLLDEHMV 288
            ..|.:|.||              :|::| :|||..         .|.:.......:|:.|  |.:
Yeast   182 NDLLRHKKRHWKDEILSQSGVLSNHNDG-KGGSVSPNDDDTHEKMTPMNSVTDYAQLKSL--HQI 243

  Fly   289 QAHGGAACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGK-VHTE---- 348
            :  |...|.......:...::..::||..:.....|...|...|..|   .:||.| :|.|    
Yeast   244 K--GTFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDT---FKNHLKALHFEYPPG 303

  Fly   349 ----QKNFV---CESCGYSCRNKETLRVHIRSHTGER 378
                .:|.|   |:.||....|.:   |.:..|.|::
Yeast   304 TKKKDRNVVPGRCKHCGLKFENVD---VWLNEHVGKQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 2/19 (11%)
zf-C2H2_8 323..411 CDD:292531 18/68 (26%)
C2H2 Zn finger 327..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 5/19 (26%)
zf-H2C2_2 367..389 CDD:290200 3/12 (25%)
C2H2 Zn finger 382..402 CDD:275368
zf-H2C2_2 395..419 CDD:290200
C2H2 Zn finger 410..430 CDD:275368
C2H2 Zn finger 438..458 CDD:275368
STP3NP_013479.3 COG5048 <137..295 CDD:227381 35/176 (20%)
C2H2 Zn finger 144..161 CDD:275368 4/20 (20%)
C2H2 Zn finger 171..191 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.