Sequence 1: | NP_572449.1 | Gene: | CG2129 / 31741 | FlyBaseID: | FBgn0030008 | Length: | 465 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_116194.2 | Gene: | ZSCAN10 / 84891 | HGNCID: | 12997 | Length: | 780 | Species: | Homo sapiens |
Alignment Length: | 369 | Identity: | 102/369 - (27%) |
---|---|---|---|
Similarity: | 148/369 - (40%) | Gaps: | 95/369 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 HSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEHC 239
Fly 240 GKIYHGKYSLRQHLK---RDHDNGEEGGSAI---------FTCLECEAQLPRLRLLDEHMV---Q 289
Fly 290 AHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFF----TIRHMRNHG---- 343
Fly 344 ------------------------------------------------KVHTEQKNFVCESCGYS 360
Fly 361 CRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHS------TERPHVCSVCGATFSR 419
Fly 420 QKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKHRNDEL 463 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2129 | NP_572449.1 | C2H2 Zn finger | 296..316 | CDD:275370 | 7/19 (37%) |
zf-C2H2_8 | 323..411 | CDD:292531 | 40/149 (27%) | ||
C2H2 Zn finger | 327..346 | CDD:275368 | 9/74 (12%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 367..389 | CDD:290200 | 13/21 (62%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 395..419 | CDD:290200 | 11/29 (38%) | ||
C2H2 Zn finger | 410..430 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 438..458 | CDD:275368 | 6/19 (32%) | ||
ZSCAN10 | NP_116194.2 | SCAN | 40..124 | CDD:153421 | |
PHA03418 | 156..>314 | CDD:177646 | |||
C2H2 Zn finger | 349..370 | CDD:275368 | |||
C2H2 Zn finger | 378..398 | CDD:275368 | |||
zf-H2C2_2 | 391..415 | CDD:290200 | |||
COG5048 | 400..774 | CDD:227381 | 100/362 (28%) | ||
C2H2 Zn finger | 406..426 | CDD:275368 | 102/369 (28%) | ||
C2H2 Zn finger | 434..454 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 478..498 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 522..544 | CDD:278523 | 7/25 (28%) | ||
C2H2 Zn finger | 524..544 | CDD:275368 | 6/23 (26%) | ||
zf-H2C2_2 | 536..561 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 552..572 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 565..589 | CDD:290200 | 13/25 (52%) | ||
C2H2 Zn finger | 580..600 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 592..615 | CDD:290200 | 4/22 (18%) | ||
C2H2 Zn finger | 608..628 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 620..645 | CDD:290200 | 0/24 (0%) | ||
C2H2 Zn finger | 636..656 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 648..673 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 664..684 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 676..701 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 692..712 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 728..746 | CDD:275368 | 7/17 (41%) | ||
zf-H2C2_2 | 738..763 | CDD:290200 | 6/24 (25%) | ||
zf-C2H2 | 752..774 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 754..774 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |