Sequence 1: | NP_572449.1 | Gene: | CG2129 / 31741 | FlyBaseID: | FBgn0030008 | Length: | 465 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780372.2 | Gene: | Zfp689 / 71131 | MGIID: | 1918381 | Length: | 500 | Species: | Mus musculus |
Alignment Length: | 302 | Identity: | 92/302 - (30%) |
---|---|---|---|
Similarity: | 129/302 - (42%) | Gaps: | 65/302 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 SEDADYEPPKDAPVKSAAQEYK---------------CEHCGKIYHGKYSLRQH-----LKRDHD 258
Fly 259 NGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGA---ACVVCGRRYKTRHELKRHQLKHTSER 320
Fly 321 NVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCG---------------------YSC--- 361
Fly 362 ----RNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKG 422
Fly 423 LYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKHRNDELN 464 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2129 | NP_572449.1 | C2H2 Zn finger | 296..316 | CDD:275370 | 8/19 (42%) |
zf-C2H2_8 | 323..411 | CDD:292531 | 39/115 (34%) | ||
C2H2 Zn finger | 327..346 | CDD:275368 | 7/18 (39%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 10/47 (21%) | ||
zf-H2C2_2 | 367..389 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 395..419 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 410..430 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 438..458 | CDD:275368 | 7/19 (37%) | ||
Zfp689 | NP_780372.2 | KRAB | 29..88 | CDD:214630 | |
KRAB | 29..68 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 105..144 | 8/29 (28%) | |||
C2H2 Zn finger | 151..171 | CDD:275368 | 5/19 (26%) | ||
COG5048 | 171..>466 | CDD:227381 | 79/245 (32%) | ||
C2H2 Zn finger | 179..199 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 207..227 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 219..244 | CDD:290200 | 11/26 (42%) | ||
C2H2 Zn finger | 235..255 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 247..272 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 263..283 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 276..300 | CDD:290200 | 2/23 (9%) | ||
C2H2 Zn finger | 291..311 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 303..328 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 319..339 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 332..356 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 347..367 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 360..384 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 375..395 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 403..423 | CDD:275368 | |||
zf-H2C2_2 | 416..440 | CDD:290200 | |||
C2H2 Zn finger | 431..451 | CDD:275368 | |||
C2H2 Zn finger | 459..475 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167832293 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |