DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and ZNF747

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001291947.1 Gene:ZNF747 / 65988 HGNCID:28350 Length:331 Species:Homo sapiens


Alignment Length:147 Identity:53/147 - (36%)
Similarity:64/147 - (43%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 QLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGE 377
            ||.....|:.|        |||.      |..|....:...|..||.|...:.||..||.||.||
Human   157 QLSKARRRSRP--------RFFA------HPPVPRADQRHGCYVCGKSFAWRSTLVEHIYSHRGE 207

  Fly   378 RPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCG 442
            :||.|..|.|.|...|.|.:|.|:|..||||.|..||..|.|:..|..|..:|...|.:.|..||
Human   208 KPFHCADCGKGFGHASSLSKHRAIHRGERPHRCPECGRAFMRRTALTSHLRVHTGEKPYRCPQCG 272

  Fly   443 NAYAQAAGLAGHMRKHR 459
            ..:....|:|.|...||
Human   273 RCFGLKTGMAKHQWVHR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 2/2 (100%)
zf-C2H2_8 323..411 CDD:292531 33/87 (38%)
C2H2 Zn finger 327..346 CDD:275368 4/18 (22%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
zf-H2C2_2 367..389 CDD:290200 12/21 (57%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-H2C2_2 395..419 CDD:290200 12/23 (52%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
ZNF747NP_001291947.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
KRAB 37..96 CDD:214630
KRAB 37..76 CDD:279668
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..247 CDD:290200 11/22 (50%)
COG5048 236..>273 CDD:227381 14/36 (39%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..275 CDD:290200 7/22 (32%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.