| Sequence 1: | NP_572449.1 | Gene: | CG2129 / 31741 | FlyBaseID: | FBgn0030008 | Length: | 465 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001103494.1 | Gene: | zbtb43 / 557590 | ZFINID: | ZDB-GENE-060526-378 | Length: | 410 | Species: | Danio rerio |
| Alignment Length: | 260 | Identity: | 61/260 - (23%) |
|---|---|---|---|
| Similarity: | 93/260 - (35%) | Gaps: | 79/260 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 209 SPDVDSED--AD----------YEPP------KDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKR 255
Fly 256 DHDNGEEGGSAI--------FTCL--ECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKTRHELK 310
Fly 311 RHQLKHTSE---RNVPCPHPGCGKRFFTIRHMRNHGKVHTEQ-----------KNFVCESCGYSC 361
Fly 362 RNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHH 426
Fly 427 426 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2129 | NP_572449.1 | C2H2 Zn finger | 296..316 | CDD:275370 | 3/19 (16%) |
| zf-C2H2_8 | 323..411 | CDD:292531 | 26/98 (27%) | ||
| C2H2 Zn finger | 327..346 | CDD:275368 | 0/18 (0%) | ||
| C2H2 Zn finger | 354..374 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 367..389 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 382..402 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 395..419 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 410..430 | CDD:275368 | 5/17 (29%) | ||
| C2H2 Zn finger | 438..458 | CDD:275368 | |||
| zbtb43 | NP_001103494.1 | BTB | 23..123 | CDD:279045 | |
| BTB | 34..124 | CDD:197585 | |||
| C2H2 Zn finger | 323..341 | CDD:275368 | 5/18 (28%) | ||
| C2H2 Zn finger | 349..369 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 361..384 | CDD:290200 | 8/22 (36%) | ||
| C2H2 Zn finger | 377..396 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||