DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG4936

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:499 Identity:109/499 - (21%)
Similarity:187/499 - (37%) Gaps:114/499 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DTYAGMANAKCGEIYFQSLHSFRIDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTEATDAGANLK 72
            |.|......||.:: .:....||..|    .:|  :|.....|..:..|....:.:.::....|:
  Fly    62 DHYPDKICEKCFKV-LKMAFKFRETC----QRS--YGHLRQFVGPVEVEQRPPEKKGSETATKLE 119

  Fly    73 QERD---REREP-----NSPVPI----VAQVNPFAWYEIGGDHNEDSDDERVVLEK--------Q 117
            .:.|   .|:||     :..|.:    .|:.:..|..:.|..|:|..|...|.|||        :
  Fly   120 PDVDPDEAEQEPEHDEEDEDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNE 184

  Fly   118 DEDED----------ERPGRSIIKWQ--DHQSLTSESLRQVRALKVDYKE--------EDSEQEE 162
            ..:||          |.....:|..|  ||: :..::|.::.| :::|.:        |.:.:::
  Fly   185 QVEEDGIIEEVYDVYETYEGDLIPDQGYDHE-MADQALSELSA-EIEYLDQVEHDQLTESAHEDD 247

  Fly   163 CGMELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHI--MRQHKDTLSPDVD---SEDADYEPP 222
            ..::|:...|....:|...:..|      :|...:|.:  .|....|.|..|:   |:..|...|
  Fly   248 AEVDLNSTEEEFVPSKSVRASIH------ARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNP 306

  Fly   223 KDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHM 287
                                          ||....|.:..||.:  .::.|..:.    :.|.:
  Fly   307 ------------------------------LKVRRGNSDSAGSKM--SIKSEKDIS----IGEVL 335

  Fly   288 VQAHGGAACVVCGRRYKTRHEL---KRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQ 349
            .:.|.|.       :.|..|::   .:.:.|:..:        .||..:.:...:..|.|||:..
  Fly   336 ARKHSGI-------KTKGGHKILLGDKKEFKYICD--------VCGNMYPSQSRLTEHIKVHSGV 385

  Fly   350 KNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCG 414
            |...||.||:.....:.|..|:.:|||.||:.|..|...|...|...:|..:|:.|||:.|.||.
  Fly   386 KPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCH 450

  Fly   415 ATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKH 458
            .||:....|..||.:|...|..||.:||..:.||..|..|...|
  Fly   451 KTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 2/22 (9%)
zf-C2H2_8 323..411 CDD:292531 27/87 (31%)
C2H2 Zn finger 327..346 CDD:275368 4/18 (22%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 367..389 CDD:290200 9/21 (43%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
zf-H2C2_2 395..419 CDD:290200 10/23 (43%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 438..458 CDD:275368 7/19 (37%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 9/39 (23%)
C2H2 Zn finger 362..382 CDD:275368 4/27 (15%)
zf-H2C2_2 375..399 CDD:290200 9/23 (39%)
COG5048 386..>447 CDD:227381 21/60 (35%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 10/22 (45%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 9/21 (43%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.