DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG6654

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:452 Identity:110/452 - (24%)
Similarity:166/452 - (36%) Gaps:105/452 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NLKQERDREREPNSPVPIVAQVNPFAWYEIGGDHN-------------EDSDDERVV-------- 113
            |||.|::         .:..|.|..  || |.||.             |..|:|..:        
  Fly   175 NLKDEKE---------VVFTQTNVI--YE-GDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQV 227

  Fly   114 ---------LEKQDEDEDERP------GRSIIKWQDHQSLTSESLRQ------VRALKVDYKEED 157
                     |.:|:.|:.:.|      .|.:.|.|..||....|.|:      |.|......|..
  Fly   228 TTRKSAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPS 292

  Fly   158 SEQEECGMELDLD-------------SEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLS 209
            .:|...|.:..|.             |....:.::.:.|..|...:...|.|..|  |:.|..::
  Fly   293 PKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIH--RRQKGCIN 355

  Fly   210 PDVDSEDADYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECE 274
                                  :.|||..|.|::         :..||....:.......|.||.
  Fly   356 ----------------------RNYKCNECEKVF---------VSPDHLAEHQASHGAHNCPECG 389

  Fly   275 AQLPRLRLLDEHMVQAHG---GAACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTI 336
            .:......|.:||||.|.   ...|.:|.:.:.....|:.|...||.|:...|..  |||.|...
  Fly   390 IRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNI--CGKSFTQN 452

  Fly   337 RHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAM 401
            .::|.|...|:|.|:|.||.|.:|...|..|..|.|:|||::||.|:||..||.:...|.:|...
  Fly   453 ANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRK 517

  Fly   402 HSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKHRNDEL 463
            |:.|||:.|.:|...|:....|.:|:..|...:.:||..|...:.|......|.|.|:.:.:
  Fly   518 HTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERI 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 4/19 (21%)
zf-C2H2_8 323..411 CDD:292531 35/87 (40%)
C2H2 Zn finger 327..346 CDD:275368 6/18 (33%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
zf-H2C2_2 367..389 CDD:290200 11/21 (52%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-H2C2_2 395..419 CDD:290200 9/23 (39%)
C2H2 Zn finger 410..430 CDD:275368 5/19 (26%)
C2H2 Zn finger 438..458 CDD:275368 5/19 (26%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 7/24 (29%)
COG5048 <357..570 CDD:227381 68/223 (30%)
C2H2 Zn finger 360..380 CDD:275368 5/28 (18%)
C2H2 Zn finger 385..406 CDD:275370 8/20 (40%)
C2H2 Zn finger 414..434 CDD:275368 4/19 (21%)
zf-H2C2_2 427..451 CDD:290200 10/25 (40%)
C2H2 Zn finger 442..490 CDD:275368 19/49 (39%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 13/24 (54%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 510..534 CDD:290200 8/23 (35%)
C2H2 Zn finger 526..546 CDD:275368 5/19 (26%)
zf-H2C2_2 539..563 CDD:290200 6/23 (26%)
C2H2 Zn finger 554..574 CDD:275368 5/19 (26%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.