DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG31388

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:379 Identity:83/379 - (21%)
Similarity:140/379 - (36%) Gaps:85/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EKQDEDEDERPG-------------RSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEECGME 166
            |.||::.||...             :|:...|....|:::|........:....|...:.|.   
  Fly   124 EPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEA--- 185

  Fly   167 LDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAA 231
              :|:....|:   |:|..|...:::...|:.|  :.|...:.||.                   
  Fly   186 --IDNRDTSSS---HTCSKCGLEFENVDELKLH--KYHLHDIPPDT------------------- 224

  Fly   232 QEYKCEHCGKIYHGKYSLRQH-----LKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAH 291
             ::.|:||.:.:....:|.:|     |...|           :|.:|::|.....||:.|..:..
  Fly   225 -KFVCDHCDEGFRSAAALTRHCNMINLPLTH-----------SCTKCKSQFHNHILLETHKQRCL 277

  Fly   292 GGAA----CVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNF 352
            ...|    |.:||:...|...||.|.::|...|...|..  |...|:|...:.:|.|.||.::.:
  Fly   278 RPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQ--CSASFYTAAELCSHQKTHTTERPY 340

  Fly   353 VCE-SCGYSCRNKETLRVHIRSH--TGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCG 414
            :|. :||.:.|......:|.|.|  ..:|.:.|:.|.|.:.:.|..|.|...|:..|.|.|.:|.
  Fly   341 ICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICR 405

  Fly   415 ATFSRQKGLYHHKFLHADTKQFVCKLCGNAY----AQAAGLAGHMRKHRNDELN 464
            .:|...|....|             |..||:    |:|...|....:.||...|
  Fly   406 ISFKTAKHYRSH-------------LKSNAHKTLEARAKAAASPNSRGRNCSTN 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 7/19 (37%)
zf-C2H2_8 323..411 CDD:292531 25/90 (28%)
C2H2 Zn finger 327..346 CDD:275368 5/18 (28%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 367..389 CDD:290200 7/23 (30%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 8/23 (35%)
C2H2 Zn finger 410..430 CDD:275368 5/19 (26%)
C2H2 Zn finger 438..458 CDD:275368 6/23 (26%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 6/25 (24%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 6/21 (29%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368 6/19 (32%)
C2H2 Zn finger 401..419 CDD:275368 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.